(data stored in ACNUC7421 zone)

EMBL: CP000251.PE15

CP000251.PE15        Location/Qualifiers
FT   CDS_pept        19187..19912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0015"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79793"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILV9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79793.1"
FT                   /translation="MALPPQKPGRPAGPPPSAEEAARAARHATDELTDETAKLEEELEA
FT                   LKARYEQYFLGTERREPARWRDEVRKKVLRLKGAFTRNTGLRFRIQSLHARYLSYERLW
FT                   QRSVREREEGTYRRDLVKARRRAGEAEAAPGNAAAPAPAATPSPSVNASAPPARTPAPP
FT                   TSAPPAGGDEARMRALYDAYIAAKRQCNEDVSRLSYDVVARSVAKQVPEVMARFKAKAV
FT                   DFRVEVKDGKAILKAIPRV"
     gtggcgctcc ctccgcagaa gcccggacgt cccgccggtc ccccgccgtc cgcggaggag        60
     gccgcgcgcg ccgcgcgcca cgccaccgac gagctcaccg acgagaccgc caagctggag       120
     gaggagctcg aggcgctgaa ggcgaggtac gagcagtact tcctcggcac cgagcggcgc       180
     gagcccgcgc gctggcgcga cgaggtgcgc aagaaggtgc tccggctgaa gggcgcgttc       240
     acccgcaaca ccgggctccg cttccggatc cagtcgctcc acgcgcgcta cctgtcctat       300
     gagcggctgt ggcagcggag cgtgcgcgag cgcgaggagg gcacctaccg gcgcgacctc       360
     gtgaaggcgc ggcgccgcgc gggcgaggcc gaggccgcgc ccggcaacgc ggccgccccg       420
     gcgcccgccg cgacgccgtc accatcggtg aacgcctcgg cgccgccggc ccgcacccct       480
     gcgccgccga catcggcgcc gcccgccggc ggcgacgagg cgcggatgcg agcgctctac       540
     gacgcgtaca tcgcggcgaa gcggcagtgc aacgaggacg tctcgcggct cagctacgac       600
     gtggtcgccc gcagcgtggc gaagcaggtc cccgaggtca tggcgcggtt caaggccaag       660
     gcggtggact tccgcgtcga ggtgaaggac ggcaaggcga tcctgaaggc gatcccccgc       720
     gtctga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page