(data stored in ACNUC7421 zone)

EMBL: CP000251.PE16

CP000251.PE16        Location/Qualifiers
FT   CDS_pept        20149..20520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79794"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILV8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79794.1"
FT                   /translation="MRALLPSIAAVLLCAACGRSDADARRARLGAERRALEATLDHLED
FT                   RLIVNQARVRFWREMQARHESVTAVACTSQEEHAIEMARHVLPDEPARRAGRRASIDRA
FT                   RVAAAPRAPAPVPVRAAAP"
     ttgcgagcgc ttttgccgtc gatcgccgcc gtcctgctct gcgctgcgtg cggcaggtcc        60
     gacgcggacg cgcgccgggc gcggctcggg gccgagcgtc gcgcgctcga ggcgacgctc       120
     gatcacctcg aggatcgcct catcgtgaac caggcgcgcg tgcgcttctg gcgggagatg       180
     caggcgcgcc acgagagcgt caccgccgtc gcctgcacct cgcaggagga gcacgccatc       240
     gagatggcgc gccacgtcct gcccgacgag cccgcccgcc gcgccggccg ccgcgcctcg       300
     atcgaccgcg cccgcgtggc cgccgccccc cgcgccccgg ccccggtgcc cgtccgcgcc       360
     gccgccccct ag                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page