(data stored in ACNUC7421 zone)

EMBL: CP000251.PE161

CP000251.PE161       Location/Qualifiers
FT   CDS_pept        186114..187604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0162"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79939"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMA8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79939.1"
FT                   /translation="MSLTARELAQVVAELAPLAGAYVEAVRAHAERALTLSLRGRAGDA
FT                   LLLLSAEPDVTRLHAARRRPPQPDAPYAVQAVLRRELEGARLAGLETLPGDRVVALSFE
FT                   RAPARGGPVRLVAELTGRHGNLFLVDAAGIIRAAAARNLSQRRDLAVGRPYQPPSLPPA
FT                   GPGSDAGQGAPRFAPVPGTPFPLSAAIEDAYLAREEERRLAEGRRRLREPVRAALARAG
FT                   RALAKLADEAARVPAAEADRRAADLLKTHLRAVRRGATEVAVTEWTEEGPREVRVAVDP
FT                   ALTPQANLERYYRRYRRIVESAARVEARAAEVRAREAALRALLGRIDAAGAADLPRLER
FT                   EARRLAAGPRPAAPPRRKRDEPALPYRTFRSLSGATILVGRGAAENDALTLRVARGNDL
FT                   WLHARGLPGAHVVVRLDKAKAPDAETLVDAAHLAVHFSDARGAPQADVAYTRARFVKKP
FT                   KGSAPGAVTYSQEKVLLLRTEPGRVERLLAEEEGGQGG"
     atgtcgctca ccgctcgcga gctcgcccag gtggtcgccg agctcgcccc gctcgccggg        60
     gcgtacgtcg aggcggtgcg cgcgcacgcg gagcgggcgc tcaccctgtc gctccgcggc       120
     cgcgccggcg acgcgctgct gctgctctcc gccgagcccg acgtcacccg cctccacgcg       180
     gcccgccgcc gccccccgca gcccgacgcc ccctacgccg tccaggcggt gctccgccgc       240
     gagctggagg gcgcgcgcct cgccggcctg gagacgctcc cgggcgaccg ggtggtggcg       300
     ctctccttcg agcgcgcccc ggcgcggggc gggccggtac gcctggtggc ggagctcacc       360
     ggccggcacg gcaacctgtt cctggtggac gcggccggga tcatccgcgc cgccgccgcc       420
     cgcaacctct cgcagcgccg cgacctcgcc gtgggccggc cctaccagcc gccctcgctc       480
     ccgcccgccg gccccggctc cgacgccggc cagggcgcgc cccggttcgc gccggtgccc       540
     ggcacgccgt tcccgctctc ggccgcgatc gaggacgcct acctcgcgcg cgaggaggag       600
     cggcgcctgg ccgaggggcg gcggcggctg cgcgagccgg tgcgcgcggc gctggcccgg       660
     gccgggcgcg cgctcgcgaa gctcgccgac gaggcggcgc gcgtgccggc cgccgaggcg       720
     gaccgccgcg ccgccgacct gctcaagacc cacctgcgcg ccgtccggcg cggcgcgacc       780
     gaggtcgcgg tcaccgagtg gaccgaggag ggcccgcgcg aggtgcgcgt ggcggtggac       840
     ccggcgctca cgccccaggc gaacctggag cggtactacc ggcgctaccg ccgcatcgtg       900
     gagagcgccg cccgggtgga ggcccgcgcc gccgaggtcc gcgcccgcga ggccgcgctg       960
     cgcgcgctcc tcggccggat cgacgccgcc ggcgccgccg acctgccgcg cctcgagcgc      1020
     gaggcccgcc gcctggccgc cggcccgcgc ccggccgcgc cgccgcgccg caagcgcgac      1080
     gagcccgcgc tgccctaccg caccttccgc tcgctctccg gcgcgacgat cctggtcggg      1140
     cgcggggcgg ccgagaacga cgcgctcacg ctgcgcgtcg cccgcggcaa cgacctgtgg      1200
     ctgcacgcgc gcgggctgcc cggcgcccac gtggtggtcc ggctcgacaa ggcgaaggcg      1260
     ccggacgcgg agacgctcgt ggacgccgcc cacctcgcgg tgcacttctc cgacgcccgc      1320
     ggcgcgccgc aggccgacgt cgcctacacc cgcgcccgct tcgtgaagaa gccgaagggc      1380
     tcggcgccgg gcgcggtcac ctacagccag gagaaggtcc tgctcctgcg caccgagccc      1440
     gggcgcgtcg agcgcctgct cgccgaggag gagggcgggc agggcggcta g               1491
//

If you have problems or comments...

PBIL Back to PBIL home page