(data stored in ACNUC7421 zone)

EMBL: CP000251.PE165

CP000251.PE165       Location/Qualifiers
FT   CDS_pept        complement(195111..196292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0166"
FT                   /product="integral membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79943"
FT                   /db_xref="GOA:Q2IMB3"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMB3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79943.1"
FT                   /translation="MTTRARLLTFGLAAAWLAIGYLNVARGASHAGAGYRFWSFQHHCY
FT                   SDVIALHGDRYLGGGRPLPYLEDRIEYPVLLGIALWLPSFVPGGALVHFTVTYALLALC
FT                   LFAALLALERLPGARPFWLGATPALVYYAGLNWDLLPIALLCAALLALARGRPGAGGAL
FT                   TALGTSAKLFPGVLAPPALLALAAEPSRAPLLRFGAGLAGALLAVNLPFALAAPEGWSW
FT                   FFRFNAGRGAENSIWDALGVGRGPWLEVLSTGPMLLAVALGCAAAWRAARAGGDARRAV
FT                   RLAVALALTAWIATNKIWSPQYALYGFLAGALAAAPTGLFLVLSAVSVADFHVAFEVRA
FT                   RRWDPWFRDHLFHPDGVVRSVLWLALAAWIARELWRCARAAPAAGTVSSPSTR"
     gtgaccaccc gcgcccggct cctcaccttc ggcctcgccg cagcctggct ggcgatcggc        60
     tacctgaacg tcgcgcgcgg ggcctcgcac gccggcgccg gctaccgctt ctggtcgttc       120
     cagcaccact gctactccga cgtgatcgcg ctgcacggcg accgctacct gggcggcggc       180
     cggccgctgc cgtacctcga ggaccggatc gagtacccgg tgctgctggg catcgcgctg       240
     tggctcccga gcttcgtccc gggcggcgcg ctcgtgcact tcaccgtgac ctacgccctg       300
     ctggcgctgt gcctgttcgc ggcgctgctc gcgctggagc ggctgcccgg ggcgcgcccg       360
     ttctggctcg gcgcgacgcc ggcgctcgtc tactacgccg ggctgaactg ggacctgctg       420
     cccatcgcgc tcctctgcgc ggcgctgctc gcgctcgcgc gcggccgccc gggcgcgggc       480
     ggggcgctca ccgccctcgg cacctcggcg aagctgttcc cgggcgtgct cgcgccgccg       540
     gcgctcctcg cgctcgccgc cgagccgtcg cgcgcgccgc tcctccgctt cggcgcgggc       600
     ctcgccggcg cgctcctcgc cgtgaacctg ccgttcgcgc tcgccgcccc ggagggctgg       660
     agctggttct tccgcttcaa cgccgggcgc ggcgccgaga actcgatctg ggacgcgctg       720
     ggcgtggggc gcggcccctg gctcgaggtc ctctccaccg ggccgatgct cctcgcggtc       780
     gcgctcggct gcgccgcggc ctggcgcgcc gcgcgggccg ggggcgacgc ccgccgggcg       840
     gtgcggctcg cggtggcgct cgcgctcacc gcctggatcg ccacgaacaa gatctggagc       900
     ccgcagtacg cgctctacgg cttcctggcg ggcgcgctcg ccgccgcccc caccggcctc       960
     ttcctcgtgc tgagcgcggt gtccgtcgcc gacttccacg tcgcgttcga ggtccgggcc      1020
     cggcgctggg acccctggtt ccgggaccac ctgttccacc cggacggcgt ggtccgctcg      1080
     gtgctctggc tcgcgctcgc cgcgtggatc gcgcgcgagc tgtggcgctg cgcgcgggcc      1140
     gccccggcgg ccgggacggt cagtagtcct tcgaccagat ga                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page