(data stored in ACNUC7421 zone)

EMBL: CP000251.PE168

CP000251.PE168       Location/Qualifiers
FT   CDS_pept        198326..198994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79946"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMB7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79946.1"
FT                   /translation="MSGRTVRRPARKAPPTIDRTATLALADRARARGRRRKAVALYQRV
FT                   LAQHPEDLAVHGKVAPLLAARGEREAALRSFRAAIDGHRRAGFVDRALAVLAQATEAFP
FT                   RDDGLWEEMGSLELSRGRRADAVAALVRGGRTLLAARALGPAERLLHAAGRLEPWHGEA
FT                   TLLLARAWARSGRRRDAIRLLEGLAQRTGGRTRAAARALALRLSPTPARLWRWLRPSTG
FT                   "
     gtgtccggcc gcaccgtccg tcgccccgcc cgcaaggcgc cgcccaccat cgaccgcacc        60
     gccacgctcg cgctcgccga ccgggcgcgg gcgcgcggcc gccgccggaa ggcggtggcg       120
     ctctaccagc gcgtgctcgc gcagcacccc gaagatctcg ccgtgcacgg gaaggtggcg       180
     ccgctgctcg ccgcgcgcgg cgagcgcgag gcggcgctgc gcagcttccg cgccgccatc       240
     gacggccacc gccgcgccgg gttcgtggac cgcgcgctgg cggtgctggc gcaggccacc       300
     gaggcgttcc cgcgcgacga cggcctgtgg gaggagatgg ggagcctgga gctgtcgcgc       360
     gggcggcgcg ccgacgcggt ggcggcgctg gtgcgcggcg gccgcacgct gctcgccgcg       420
     cgcgcgctcg gcccggcgga gcggctgctc cacgcggccg ggcgcctcga gccgtggcac       480
     ggcgaggcga cgctgctgct cgcgcgcgcc tgggcgcgct ccggccggcg gcgcgacgcg       540
     atccggctgc tggaggggct ggcgcagcgg accggcgggc gcacccgcgc cgcggcccgc       600
     gcgctggcgc tccggctctc tccgaccccc gcgcggctct ggcgctggct gcgcccctcg       660
     accggctag                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page