(data stored in ACNUC7421 zone)

EMBL: CP000251.PE17

CP000251.PE17        Location/Qualifiers
FT   CDS_pept        complement(20834..21325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0017"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79795"
FT                   /db_xref="GOA:Q2ILW5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILW5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79795.1"
FT                   /translation="MNPTFDVMPDPPPRALVLHPEVSVRAELGWALGARDMASISAADG
FT                   ASGLALLLEELLSLDALVVALDLPGRDARAFADLVRRAGGEQELAIVVLASDPSPSLRD
FT                   ELAALGVDEVVDPRLGPDAVADAVVAAVQGRRAGAGIRPPRSSRGFGEPERLDPFRSAA
FT                   "
     atgaacccga cgttcgatgt gatgccggat ccgccccctc gcgcgctcgt cctccacccg        60
     gaggtctcgg tgcgcgccga gctgggctgg gcgctcggcg cccgggacat ggcgtccatc       120
     tcggcggccg acggcgcgag cggcctcgcg ctcctgctcg aggagctcct ctcgctcgac       180
     gcgctggtcg tggcgctcga tcttcccggc cgcgacgccc gcgcgttcgc cgacctcgtc       240
     cgccgggccg gcggagagca ggagctcgcc atcgtggtcc tcgcgagcga cccgagcccg       300
     tccctgcgcg acgagctcgc cgcgctcggc gtggacgagg tggtggaccc gcgcctcggg       360
     ccggacgcgg tggccgacgc cgtggtcgcg gcggtccaag gacgtcgcgc cggcgccggc       420
     atccgcccgc cgcgctcctc gcgcggcttc ggcgaaccgg agcggctgga cccgttccgc       480
     tccgccgcgt ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page