(data stored in ACNUC7421 zone)

EMBL: CP000251.PE172

CP000251.PE172       Location/Qualifiers
FT   CDS_pept        complement(202166..202699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0173"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79950"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMC2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79950.1"
FT                   /translation="MRRIALAALAVSLASGCASREALWRYREEGTFGDGAPPLHAEPIG
FT                   EGAEYRLVAASLGEADLSVERSVAAVGDAPVRVDLGRVRLRSASGEELPLVRACLLEAA
FT                   PRCTAGGASRGFVATLSPGEVVRFRADFGPVDGLGPDRAPNPEVLKLTLSEEGVYVGGR
FT                   LQPVTVVLERVPAR"
     atgcgccgga tcgccctcgc cgccctggcc gtgtcgctcg cctccggctg cgcctcgcgc        60
     gaggcgctgt ggcgctaccg cgaggagggc acgttcggcg acggcgcgcc gccgctccac       120
     gccgagccga tcggcgaggg cgccgagtac cggctggtgg cggcctcgct cggcgaggcg       180
     gatctctcgg tggagcggag cgtggcggcg gtgggcgacg cgccggtgcg ggtggacctg       240
     ggccgggtgc gcctgcgctc ggcgagcggc gaggagctcc cgctcgtgcg cgcctgcctg       300
     ctggaggcgg ccccgcgctg caccgcgggg ggcgcctcgc gcggcttcgt ggccacgctc       360
     tcgcccggcg aggtggtgcg cttccgcgcc gacttcggcc cggtggacgg cctcggcccg       420
     gaccgcgcgc cgaaccccga ggtgctgaag ctgacgctct ccgaggaggg cgtgtacgtc       480
     ggcggccggc tccagccggt cacggtggtg ctggagaggg tgccggcgcg atag             534
//

If you have problems or comments...

PBIL Back to PBIL home page