(data stored in ACNUC7421 zone)

EMBL: CP000251.PE174

CP000251.PE174       Location/Qualifiers
FT   CDS_pept        complement(204660..205829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0175"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79952"
FT                   /db_xref="GOA:Q2IMC0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMC0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79952.1"
FT                   /translation="MISSAASRGPVRPETVEPGRGDGQDGGAGEAGPGKETSLRRPRAA
FT                   SAAVRPEAWPALAMFGVCALLAAETALLAAIGLGAGDALLPGGDHEGVLFGASLAAAVL
FT                   GGALASMTLLRALRASRADRDGRAQAEAALRTRDEFLGLAAHELKTPLTALFLELGAAG
FT                   RDAARRGDEAARGHLSRADRAARRLAELVSRLLVDARAAAEPLALEEVDLGALANDAVD
FT                   ARRELFDRARCDVTVRAEGPVSGRWDRTRVDRALASLLANAAKYGQGRPIEVTVRAEGA
FT                   QARLSVRDHGIGIPPERRAAIFDRYARAVSARHYGGLGLGLWIARREALALGGTVTVES
FT                   RPGHGAEFTLRLPAGAVAPLRGLPRAAGGALARAPARALRWLAWRSRRC"
     atgatcagca gcgcagcgag ccggggcccg gtgcggccgg agacggtcga gccggggcgg        60
     ggggacggcc aggacggcgg ggccggcgag gccggccccg ggaaggagac gagcctgcgg       120
     cgcccgcgcg ccgcctcggc ggcggtgcgc cccgaggcgt ggccggcgct cgccatgttc       180
     ggcgtgtgcg ccctgctcgc ggccgagacg gcgctcctcg ccgccatcgg cctcggcgcg       240
     ggggacgcgc tgctgcccgg cggcgatcac gagggcgtgc tgttcggggc ctcgctcgcc       300
     gcggcggtgc tgggcggcgc gctcgcctcg atgacgctgc tccgcgcgct gcgcgcctcg       360
     cgcgccgacc gcgacgggcg cgcccaggcc gaggcggcgc tgcgcacccg cgacgagttc       420
     ctcggcctcg ccgcccacga gctgaagacg ccgctcaccg ccctgttcct ggagctcggc       480
     gccgcggggc gcgacgcggc ccggcgcggc gacgaggcgg cgcgggggca cctgtcgcgc       540
     gccgatcgcg ccgcgcgacg gctcgccgag ctggtctcgc gcctgctggt ggacgcgcgc       600
     gcggccgcgg agccgctcgc gctcgaggag gtggacctcg gggcgctggc gaacgacgcg       660
     gtggacgcgc gccgcgagct gttcgaccgc gcccgctgcg acgtcacggt tcgcgccgag       720
     ggcccggtga gcgggcgctg ggatcgcacg cgggtcgatc gcgcgctcgc cagcctgctc       780
     gcgaacgccg ccaagtacgg gcaggggcgg ccgatcgagg tgacggtccg cgccgagggc       840
     gcgcaggccc ggctctcggt gcgcgaccac ggcatcggca tcccgccgga gcgccgcgcc       900
     gccatcttcg accgctacgc gcgggcggtg tcggcccgcc actacggcgg cctcgggctc       960
     ggcctctgga tcgcgcgccg cgaggcgctc gcgctcggcg gcacggtgac ggtggagagc      1020
     cggcccggcc acggcgccga gttcacgctg cggctcccgg cgggcgcggt ggcgccgctg      1080
     cgcgggctcc cccgcgcggc ggggggcgcg ctggcccggg cgcccgcgcg ggcgctgcgc      1140
     tggctggcgt ggcgcagccg ccggtgctag                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page