(data stored in ACNUC7421 zone)

EMBL: CP000251.PE179

CP000251.PE179       Location/Qualifiers
FT   CDS_pept        209673..210017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0180"
FT                   /product="Histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79957"
FT                   /db_xref="GOA:Q2IMC4"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMC4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79957.1"
FT                   /translation="MSDCLFCKIARGELPAKLVHQDADTVAFVDVNPQAPTHLLVIPRK
FT                   HIPTVNDLSAEDEALMGKLYRVAAALAKERGVDGSGWRAVVNTHGDAGQTVFHVHLHLL
FT                   GGRRMAWPPG"
     atgagcgact gcctgttctg caagatcgcg cggggcgagc tccccgccaa gctggtgcac        60
     caggacgccg acacggtggc gttcgtggac gtcaacccgc aggcgcccac gcacctgctg       120
     gtcatcccgc gcaagcacat ccccaccgtg aacgacctct ccgccgagga cgaggcgctc       180
     atggggaagc tgtaccgggt ggcggcggcg ctcgcgaagg agcgcggggt ggacgggtcc       240
     ggctggcgcg ccgtcgtgaa cacgcacggc gacgcggggc agaccgtgtt ccacgtccac       300
     ctgcacctgc tcggcggccg ccgcatggcc tggcccccgg gctag                       345
//

If you have problems or comments...

PBIL Back to PBIL home page