(data stored in ACNUC7421 zone)

EMBL: CP000251.PE192

CP000251.PE192       Location/Qualifiers
FT   CDS_pept        220799..221851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79970"
FT                   /db_xref="InterPro:IPR025409"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMD7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79970.1"
FT                   /translation="MTDSFDLGAFRRDLTRRTADAVHALRARIGSETLYGFALFTSGER
FT                   DFAWVRASANTEDALTRRAAAAAALDPRFRGEAGRRLLRWSAPDWEYHDFAPEVRGLAV
FT                   PPAEGRRPTLDPALYDAFVGALKAVDRAGLFGRGADRAFLTVNILCDHASPAFFRRGLR
FT                   ALNPVPTAERHLHETAAAPFVRCVNRAPRRERMRIWLALYEDLYMEWRTPIAEEARARG
FT                   LSPWDVEEELARFGRKVVPALVDLLAHYGFAAPIDHNRGFETREVWLAGSALFLVRRIG
FT                   MVAEAEIARLQRLVGDFAERDRRLRVASTLAENTARVLHELRPRRFPPSEMDPLTFKLT
FT                   NPEPFLLRRP"
     gtgacggatt ccttcgacct gggcgccttc cgccgcgacc tcacccgccg gacggccgac        60
     gcggtgcacg cgctgcgggc ccgcatcggc tccgagaccc tgtacggctt cgcgctgttc       120
     acgagcgggg agcgcgactt cgcctgggtg cgcgcctccg ccaacaccga ggacgcgctc       180
     acccggcgcg ccgccgccgc ggccgcgctg gacccgcgct tccggggcga ggccgggcgg       240
     cgcctgctgc gctggtcggc gccggactgg gagtaccacg acttcgcgcc ggaggtccgc       300
     gggctggcgg tgccgccggc ggagggccgc cgccccacgc tcgacccggc gctctacgac       360
     gcgttcgtgg gcgcgctgaa ggcggtggac cgggccgggc tgttcggccg cggcgccgac       420
     cgcgccttcc tcaccgtgaa catcctctgc gaccacgcct cgccggcgtt cttccggcgc       480
     gggctccgcg cgctcaaccc ggtgcccacg gcggagcggc acctgcacga gaccgccgcc       540
     gcgccgttcg tgcggtgcgt gaaccgcgcc ccccgccgcg agcggatgcg catctggctg       600
     gcgctctacg aggacctcta catggagtgg cgcacgccca tcgccgagga ggcgcgggcg       660
     cgggggctga gcccctggga cgtggaggag gagctggcgc gcttcgggcg caaggtggtg       720
     ccggcgctcg tggacctgct cgcgcactac ggcttcgccg cgcccatcga ccacaaccgc       780
     ggcttcgaga cgcgcgaggt gtggctggcc ggctcggcgc tgttcctggt gcggcgcatc       840
     gggatggtgg cggaggcgga gatcgcgcgg ctgcagcggc tggtgggcga cttcgccgag       900
     cgcgaccgcc gcctgcgggt cgcgtccacc ctcgccgaga acaccgcccg cgtgctgcac       960
     gagctccgcc cgcgccgctt cccgccctcg gagatggacc cgctcacctt caagctcacg      1020
     aaccccgagc cgttcctgct gcggcggccc tga                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page