(data stored in ACNUC7421 zone)

EMBL: CP000251.PE193

CP000251.PE193       Location/Qualifiers
FT   CDS_pept        221900..222718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0194"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79971"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMD6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79971.1"
FT                   /translation="MTDRSRRARPAAARPSPHDRHVLYERAVQHAGSELDLVDRVVRRG
FT                   GGTPRRLREDFSGTALLSAAWVRRGRDRSAVAVDLDASVHGWARAHRVPALGAAAARLR
FT                   LVEADVRDGPPGPFDAVIAFNFSYGVLQTRAALGGYLRSAAAALAPRGALLLDAYGGWD
FT                   AEKELTERRRIGGGVSYVWEQESFDPITRRVRCAIHFELPGGRRLRRAFTYDWRLWTIP
FT                   ELTELVGEAGLEPEVLWDVAPRGATRYLPRRSASNQGGWIAYVVGRPKRA"
     atgaccgacc gaagccgccg agcccgcccc gccgccgcac gcccatcgcc gcacgaccgc        60
     cacgtcctgt acgagcgcgc cgtccagcac gccggcagcg agctcgacct ggtggaccgg       120
     gtggtgcgcc gcggcggggg gacgccgcgg cggctgcgcg aggacttcag cggcaccgcg       180
     ctcctctccg ccgcctgggt ccggcgcggc cgggatcgca gcgcggtggc ggtggacctc       240
     gacgcctcgg tgcacggctg ggcgcgcgcc caccgggtgc cggccctggg cgccgcggcg       300
     gcgcggctcc ggctggtgga ggccgacgtg cgggacgggc cgccggggcc gttcgacgcg       360
     gtgatcgcgt tcaacttcag ctacggcgtg ctccagacgc gcgcggcgct gggcggctat       420
     ctccggtccg cggccgccgc cctggcgccg cgcggcgcgc tcctgctcga cgcgtacggc       480
     ggctgggacg ccgagaagga gctcacggag cggcggcgca tcggcggcgg cgtgagctac       540
     gtgtgggagc aggagtcgtt cgaccccatc acccgccggg tccgctgcgc catccacttc       600
     gagctgcccg gcggccggcg cctgcgccgc gccttcacct acgactggcg gctctggacc       660
     atccccgagc tcaccgagct ggtgggcgag gccgggctcg agccggaggt gctgtgggac       720
     gtggcgccgc ggggcgcgac ccggtacctg ccgcgccgct ccgcctcgaa ccagggcggg       780
     tggatcgcgt acgtggtggg gcggccgaag cgggcctag                              819
//

If you have problems or comments...

PBIL Back to PBIL home page