(data stored in ACNUC7421 zone)

EMBL: CP000251.PE195

CP000251.PE195       Location/Qualifiers
FT   CDS_pept        complement(223637..223912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0196"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79973"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IME2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79973.1"
FT                   /translation="MPIYEYECPKCGRFDALQKMSDPALQVHEVCGSKVRKLMSASAFA
FT                   FKGSGFYITDYGGKSAAAITPDRKPESKPEPKSDACAGCPASKSAA"
     atgcccatct acgagtacga gtgccccaag tgcgggaggt tcgacgccct gcagaagatg        60
     tcggatccgg cgctgcaggt gcacgaggtg tgcggctcga aggtgcggaa gctgatgtcg       120
     gcgagcgcgt tcgcgttcaa gggctcgggc ttctacatca ccgactacgg cgggaagagc       180
     gccgccgcga tcaccccgga ccggaagccg gagagcaagc ccgagccgaa gtccgacgcc       240
     tgcgcaggct gcccggccag caagtcggcc gcgtag                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page