(data stored in ACNUC7421 zone)

EMBL: CP000251.PE197

CP000251.PE197       Location/Qualifiers
FT   CDS_pept        complement(225549..225929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79975"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IME0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79975.1"
FT                   /translation="MDTPWAAPTMARMETKKKGTTAVVTEGSAQAALRRGPARELTPEE
FT                   ERVMRMRLGAAPPRGTPLERSAEGLSDLEIEVLSYEIEAYMKWREREHAGAAATAPARA
FT                   PAPAAPSRAKEKIIRALRKKGL"
     atggacacgc cctgggcggc gcctacgatg gcccgcatgg agacgaagaa gaagggcacc        60
     acggcggtcg tgacggaggg ctcggcccag gcggcgctcc ggcgcggccc ggcccgcgag       120
     ctgacgccgg aggaggagcg cgtcatgcgg atgcgcctcg gcgccgcccc gccccgcggc       180
     acgcccctcg agcgcagcgc cgaggggctg agcgacctcg agatcgaggt cctctcctac       240
     gagatcgagg cgtacatgaa gtggcgcgag cgcgagcacg cgggcgccgc ggcgaccgcg       300
     ccggcccgtg cgccggcccc cgccgccccc tcgcgcgcga aggagaagat catccgcgcg       360
     ctccgcaaga aaggcctgta g                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page