(data stored in ACNUC7421 zone)

EMBL: CP000251.PE2

CP000251.PE2         Location/Qualifiers
FT   CDS_pept        1811..2938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79780"
FT                   /db_xref="GOA:Q2ILU9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILU9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79780.1"
FT                   /translation="MELKIGAQELAKALGRSQGIVEKKSTMPILSHVLLEAKKGDQLVV
FT                   SATDLDLAVSSEHACEVLKEGAVAVSARHLYEIVRALPEQTVTLKKAHNNYLEVKSGPS
FT                   EFRIVGLPAEDFPALPRFDKVPFADVDPALLLEMIERTFFAVSNDETRYNLNGVYFEPA
FT                   GDALRLVATDGHRLSLSERTVGATFGLKRGVILPKKGLAELKKLLAEAAESGEEKPEAK
FT                   LGFVENSAIFRRPNVVLVMRLIEGLFPDYKQVIPKAGEKVFKVGRARFLETLRRISLLS
FT                   SDKAHAVKLDLSKDLLRVLSQNPDLGEAKEEVPVEYAGEPLKIGFNARYIMEVLQAVKS
FT                   NEVVFELADDLSPGVLKGGEEADQGFTAVVMPMRI"
     atggaactga agatcggcgc ccaggagctc gcgaaggccc tcggccgctc gcagggcatc        60
     gtcgagaaga agagcacgat gccgatcctc tcccacgtcc tgctcgaggc gaagaagggc       120
     gaccagctcg tcgtctccgc caccgacctc gacctggcgg tctcctccga gcacgcctgc       180
     gaggtgctga aggagggcgc ggtggccgtc tcggcccgcc acctctacga gatcgtccgc       240
     gccctgcccg agcagaccgt cacgctcaag aaggcgcaca acaactacct cgaggtgaag       300
     agcggcccgt ccgagttccg gatcgtcggc ctgcccgccg aggacttccc ggcgctgccc       360
     cgcttcgaca aggtgccgtt cgccgacgtg gacccggcgc tgctgctcga gatgatcgag       420
     cggaccttct tcgccgtctc gaacgacgag acccgctaca acctgaacgg cgtctacttc       480
     gagccggccg gcgacgcgct ccgcctggtc gccaccgacg gccaccgcct gtcgctctcc       540
     gagcgcaccg tgggcgccac cttcggcctg aagcgcggcg tgatcctgcc gaagaagggg       600
     ctcgccgagc tgaagaagct gctcgccgag gcggccgagt ccggcgagga gaagccggag       660
     gcgaagctcg ggttcgtgga gaacagcgcc atcttccgcc ggccgaacgt ggtgctcgtg       720
     atgcggctca tcgaggggct gttcccggac tacaagcagg tcatcccgaa ggccggcgag       780
     aaggtcttca aggtgggccg cgcccgcttc ctcgagacgc ttcggcgcat ctcgctgctc       840
     tcgtccgaca aggcgcacgc cgtgaagctg gacctctcga aggacctgct ccgcgtcctc       900
     tcgcagaacc cggacctggg agaggcgaag gaggaggtgc cggtggagta cgcgggcgag       960
     ccgctcaaga tcggcttcaa cgcgcgctac atcatggagg tcctccaggc ggtgaagtcg      1020
     aacgaggtcg tgttcgagct cgccgacgac ctctccccgg gcgtcctgaa gggcggcgag      1080
     gaggcggacc agggcttcac cgccgtcgtg atgccgatgc gcatctga                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page