(data stored in ACNUC7421 zone)

EMBL: CP000251.PE20

CP000251.PE20        Location/Qualifiers
FT   CDS_pept        complement(22777..24162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79798"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILW9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79798.1"
FT                   /translation="MSRTSRLHVLMVAILLPLAATAQTNYFPYGTAGEMQTDLVTYEGI
FT                   ARTVVVRILNLTPYRIEHTEATSTAYGDQYQVGTTLADVLDRDRLTAKAFFFAPVGVPA
FT                   VIPGVPPEAYTDGYVNTVTRPYEMVFSWNERAGRVEQSRVSWVVRGVQSWVCPPPPLGG
FT                   ECTPRHDDVHLGLWVTRPLDDPGESLYAGFFGSDFVGTMTMAVAFAGVITDPFNPLNWY
FT                   GLFIAAADMADPARFEEEQVAPDDGIEMYVASYPIPAPFTRSDPSQDCYLSNNNLVENE
FT                   LTAPSPALPDPRICTPQTVSGTADDGTDAQWADAAGPGASELITTIHVLRGRRYLPHSE
FT                   GGSACAGKWGSVPIVNVTIWTRDQYLSADVAGLAHASLASRPQRDPGAAKLVAEYRKFY
FT                   EKYDRAGLLAIREVVLALAPEAREQLRAAVLTVRSGGVLDKDAHKALHMVIVAARARLT
FT                   DDE"
     gtgagccgca cgtccaggct gcacgtcctg atggtcgcga tcctgctgcc gctcgcagcg        60
     accgcgcaga ccaactactt cccctacggc accgccgggg agatgcagac ggacctcgtc       120
     acgtacgaag ggatcgcgcg gacggtcgtc gtccggatcc tgaacctgac gccgtaccgc       180
     atcgagcaca ccgaggcgac ctccaccgcg tacggcgacc agtaccaggt cggcacgacg       240
     ctggcggacg tcctggaccg ggaccgcctc acggcgaagg cgttcttctt cgcgccggtg       300
     ggcgtcccgg cggtcatccc gggcgtcccg ccggaagcct acaccgacgg ttacgtcaac       360
     acggtgacgc gcccgtacga gatggtgttc tcgtggaacg agcgcgccgg ccgcgtcgag       420
     cagagccggg tcagctgggt ggtgcgcggg gtgcagtcgt gggtgtgccc gccgccgccc       480
     ctcggcggcg agtgcacccc gcggcacgac gacgtgcacc tgggcctctg ggtgacgcgg       540
     ccgctcgacg atcccgggga gtcgctgtac gccgggttct tcggctccga cttcgtgggc       600
     acgatgacca tggccgtcgc cttcgccggc gtgatcacgg atcccttcaa tcccctcaac       660
     tggtacggcc tcttcatcgc cgccgccgac atggcggatc cggcgcggtt cgaggaggag       720
     caggtcgcgc ccgacgacgg gatcgagatg tacgtcgcct cgtatcccat ccccgcgccg       780
     ttcacgcggt ccgatcccag ccaggactgc tacctgtcga acaacaacct cgtcgagaac       840
     gagctgacag cgccgtcgcc ggcgctgccc gatccccgga tctgcacccc ccagaccgtc       900
     tccggcacgg ccgacgacgg caccgacgcg cagtgggccg acgcggccgg gccgggcgcg       960
     tccgagctga tcacgaccat ccacgtcctt cgggggcgca ggtacctgcc ccacagcgag      1020
     ggcgggtcag cgtgtgcggg gaagtggggc tcggtgccga tcgtcaacgt gacgatctgg      1080
     acgcgggatc agtacctgag cgcggacgtc gccgggctcg cccacgcgag cctggcctcg      1140
     cgcccgcagc gcgatccggg cgcggcgaag ctcgtcgcgg agtaccggaa gttctacgag      1200
     aagtacgacc gcgccggcct cctcgcgatc cgcgaggtcg tgctggcgct cgcccccgag      1260
     gcgcgcgagc agcttcgagc ggcggtcctg accgtgcggt cgggcggcgt gctggacaag      1320
     gacgcgcaca aggcgctgca catggtgatc gtcgccgcgc gcgcccggct gacggacgac      1380
     gagtga                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page