(data stored in ACNUC7421 zone)

EMBL: CP000251.PE200

CP000251.PE200       Location/Qualifiers
FT   CDS_pept        complement(227991..228680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79978"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IME5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79978.1"
FT                   /translation="MRTALAAGIALGVLASCRAVQTRQDFTPVSDADFGRLGPGQLGPV
FT                   EPARADAAAARDAVARAKLRLQEAKREQGYAEADRTAAEADLQRAATEAKGANSAGDTA
FT                   WKARAQELADTAGLHRQAAEAHLAFAKRLAEARQADLDAAEAHEVSAQARLEQAKLQAL
FT                   ASAGVPAAGKYDARRFEAHVAKAVADEREAQARAAEAGRAAVAAEDGWRTLQRQWEARA
FT                   QGRGGAG"
     atgcgcaccg cgctcgcagc ggggatcgcg ctgggggtcc tggcgagctg ccgggccgtc        60
     cagacgcggc aggacttcac gccggtgtcc gacgccgact tcggccggct cgggccgggc       120
     cagctcggcc cggtggagcc ggcccgcgcc gacgcggcgg ccgcgcgcga cgcggtcgcc       180
     cgcgccaagc tgcgcctgca ggaggcgaag cgcgagcagg gctacgccga ggcggaccgc       240
     accgccgccg aggccgacct ccagcgcgcc gccaccgagg cgaagggcgc gaactcggcc       300
     ggcgacaccg cctggaaggc gcgggcgcag gagctcgcgg acaccgccgg gctgcaccgc       360
     caggccgccg aggcgcacct cgcgttcgcg aagcggctgg ccgaggcgcg gcaggccgat       420
     ctcgacgccg ccgaggcgca cgaggtgtcc gcccaggcgc gcctcgagca ggccaagctg       480
     caggcgctcg cgtcggccgg cgtcccggcg gcgggcaagt acgacgcccg ccgcttcgag       540
     gcgcacgtgg cgaaggcggt cgcggacgag cgcgaggcgc aggcgcgcgc cgcggaggcc       600
     ggccgcgcgg cggtggccgc ggaggacggc tggcggacgc tgcagcggca gtgggaggcg       660
     cgcgcgcagg ggcgcggcgg ggcggggtag                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page