(data stored in ACNUC7421 zone)

EMBL: CP000251.PE206

CP000251.PE206       Location/Qualifiers
FT   CDS_pept        234013..234531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0207"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79984"
FT                   /db_xref="GOA:Q2IME8"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IME8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79984.1"
FT                   /translation="MSAYVVDVEADGPIPGKYSMVSFGAVRVEPGLSRTFRGEVRPISD
FT                   LWLPEALAISGVTREQHLRFGEPGEVMADFERWIQETTRGKPVLFSDNLSFDWQYVNWY
FT                   FHTYLGRNPFGWSGRRIGDLYCGMVKDGHAQWKHLRATAHDHDPVNDAKANAGVLLQLV
FT                   DMGLKLNLK"
     atgtcggcgt acgtggtgga cgtggaggcg gacgggccca tcccgggcaa gtactccatg        60
     gtctcgttcg gcgcggtgcg ggtggagccc ggcctgtcgc gcaccttccg cggcgaggtc       120
     cggcccatct ccgacctgtg gctcccggag gcgctcgcga tctcgggcgt cacccgcgag       180
     cagcacctgc gcttcggcga gccgggcgag gtgatggccg acttcgagcg ctggatccag       240
     gagacgacga gggggaagcc ggtgctgttc tcggacaacc tctccttcga ctggcagtac       300
     gtgaactggt acttccacac gtacctgggc cgcaacccgt tcggctggag cggccggcgc       360
     atcggcgacc tctactgcgg gatggtgaag gacggtcacg cacagtggaa gcacctccgc       420
     gccaccgcgc acgaccacga cccggtgaac gacgcgaagg cgaacgccgg ggtgctgctg       480
     cagctcgtgg acatgggcct gaagctgaac ctcaagtga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page