(data stored in ACNUC7421 zone)

EMBL: CP000251.PE207

CP000251.PE207       Location/Qualifiers
FT   CDS_pept        234539..235147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0208"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79985"
FT                   /db_xref="GOA:Q2IMF6"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMF6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79985.1"
FT                   /translation="MTLFAQGALLGLSAAAQPGPYQAYLLAQSLRNGAVRTLPVVLVPL
FT                   TSDPPVIAAVLVALAQVPAGLLRALQLLGGAVVLWLAFSALRGLRAPLAAPEAKAPPRG
FT                   FWRAVLLNFTNPNAWIFWSAVGGPVLAAAWRDGRAEAGGFLAGFYAFLLGGNAALVAAA
FT                   GGLGRLGPRTQRALTAISGLALLAFGLWQLAKGLAGPRA"
     gtgacgctgt tcgcccaggg cgccctgctc ggcctctccg ccgcggccca gcccgggccg        60
     taccaggcct acctgctcgc gcagtcgctc cggaacggcg cggtccgcac gctgccggtg       120
     gtgctcgtgc cgctcacctc ggatccgccg gtgatcgcgg cggtgctggt ggcgctcgcg       180
     caggtgccgg cgggcctgct ccgcgcgctg cagctcctcg gcggcgcggt ggtgctgtgg       240
     ctggccttct cggcgctgcg cgggctgcgc gccccgctcg ccgcgccgga ggcgaaggcg       300
     ccgccgcgcg gcttctggcg ggcggtgctg ctcaacttca ccaacccgaa cgcctggatc       360
     ttctggagcg cggtgggggg cccggtgctc gcggccgcct ggcgggacgg ccgggccgag       420
     gcgggcgggt tcctggccgg cttctacgcg ttcctgctcg gcgggaacgc cgcgctggtg       480
     gccgcggcgg gcgggctggg ccggctcggc ccgcgcacgc agcgcgcgct caccgccatc       540
     tccgggctgg cgctgctcgc gttcgggctg tggcagctcg cgaaggggct ggccggcccg       600
     cgcgcctga                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page