(data stored in ACNUC7421 zone)

EMBL: CP000251.PE210

CP000251.PE210       Location/Qualifiers
FT   CDS_pept        237061..238200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0211"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79988"
FT                   /db_xref="GOA:Q2IMF3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IMF3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79988.1"
FT                   /translation="MSRSALRRVKRLVVKVGTGTLTDRAGRFDRDNCARLASELAEVSR
FT                   GRKVVLVSSGAVALGAERLGLARSRGKPWDLPTKQACAAAGQPHLMAAWGEALGRHGLV
FT                   TAQVLLTADDLASRKRFLNARRTFERLLDAGAVPVVNENDTVAVDELKVGDNDTLAALV
FT                   AGCVEADAVAMLTDVDGLYDRNPAEPGARLLRDVPRVTAEIERSAGGAGSERSVGGMIT
FT                   KVKAARRLGAQGVVTALLSGRRARALPALLAGEPVGTVFAPGAHRLSSRQGWLAAAARG
FT                   KGVILVDAGARRALVEQGRSLLPSGVRGVQGQFGVGDPVDVAVDPARPFARGLAGYAAD
FT                   EVRRIAGLKTGEIERALGYKYLDEIVHRNDLVVLETGRE"
     atgtcccgaa gcgccctccg ccgcgtgaag cggctcgtgg tcaaggtcgg caccggcacg        60
     ctcaccgacc gcgccggccg gttcgaccgc gacaactgcg cccggctcgc ctccgagctc       120
     gcggaggtgt cgcgcggccg gaaggtggtg ctcgtgtcct cgggcgcggt ggcgctcggc       180
     gccgagcggc tcggcctcgc gcgcagccgc ggcaagccct gggacctccc caccaagcag       240
     gcctgcgccg ccgccggcca gccgcacctc atggccgcct ggggcgaggc gctcgggcgg       300
     cacggcctcg tcaccgccca ggtgctgctc accgccgacg acctcgccag ccgcaagcgc       360
     ttcctgaacg cgcgccgcac gttcgagcgg ctgctcgacg cgggcgcggt gccggtcgtg       420
     aacgagaacg acacggtcgc ggtggacgag ctcaaggtcg gcgacaacga cacgctcgcg       480
     gcgctggtgg ccggctgcgt ggaggccgac gcggtggcga tgctcaccga cgtggacggg       540
     ctctacgatc ggaaccccgc cgagcccggg gcccggctgc tccgcgacgt gccgcgggtc       600
     accgccgaga tcgagcggag cgcgggcggg gcggggagcg agcgcagcgt gggcgggatg       660
     atcaccaagg tgaaggcggc gcggcggctc ggcgcgcagg gcgtcgtcac cgcgctcctc       720
     tccgggcgcc gcgcgcgcgc gctgccggcg ctgctcgccg gcgagccggt cggcaccgtg       780
     ttcgcgcccg gggcgcaccg gctcagctcg cgccagggct ggctcgccgc ggccgcccgc       840
     ggcaagggcg tcatcctggt ggacgcgggg gcgcggcgcg cgctggtgga gcaggggcgg       900
     agcctgctgc cgagcggcgt gcgcggcgtg cagggccagt tcggggtcgg ggacccggtg       960
     gacgtcgcgg tggacccggc ccggcccttc gcgcggggcc tggcgggcta cgccgccgac      1020
     gaggtccgcc gcatcgccgg gctcaagacc ggcgagatcg agcgcgcgct cgggtataag      1080
     tacctcgacg agatcgtcca ccggaacgac ctggtggtcc tcgagaccgg ccgggagtga      1140
//

If you have problems or comments...

PBIL Back to PBIL home page