(data stored in ACNUC7421 zone)

EMBL: CP000251.PE212

CP000251.PE212       Location/Qualifiers
FT   CDS_pept        239776..240099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0213"
FT                   /product="Iojap-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79990"
FT                   /db_xref="GOA:Q2IMF9"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMF9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79990.1"
FT                   /translation="MAIAAAALDKKAEDVTVLDVRGLTSYADYFVLMTADSDRQASAIA
FT                   DHVEQTMKAQGVTKVGVEGYQGGRWILVDYGDVVAHVMGREARGFYDLEGLWADAPRVA
FT                   VEA"
     atggcgatcg ccgcggccgc gctcgacaag aaggccgagg acgtcaccgt cctcgacgtg        60
     cgcgggctca ccagctacgc cgactacttc gtgctcatga ccgccgactc cgaccggcag       120
     gcgagcgcca tcgccgacca cgtcgagcag accatgaagg cgcagggcgt caccaaggtc       180
     ggcgtcgagg gctaccaggg cgggcgctgg atcctggtgg actacggcga cgtggtggcc       240
     cacgtgatgg gccgcgaggc ccgcgggttc tacgatctcg aggggctctg ggccgacgcg       300
     ccgcgggtgg ccgtcgaggc gtag                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page