(data stored in ACNUC7421 zone)

EMBL: CP000251.PE224

CP000251.PE224       Location/Qualifiers
FT   CDS_pept        254791..255933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0225"
FT                   /product="secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80002"
FT                   /db_xref="GOA:Q2IMH1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMH1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80002.1"
FT                   /translation="MPRATGPRRGCRLLGLALAAAVALPGCKRGGGSTAEAAQEQPPVA
FT                   LAPENVAVVSSRRLQSGPEVAGTLHARRTATLRAEVGGAVAEVRVEAGERVKAGQLLAR
FT                   IDASALQDAVRAARSAVTSAQNALRVAESSARRAHTLAREGAMAEQDAERAEAQLEAAR
FT                   AQVEDAKARLAAAEQQAGKTAVRAPFAGVVSERNVSSGDVVSSGAALYTVIDPSRLQFE
FT                   GSVPAASVGALAPGAPVDFAVTGFGGRRFDGHIERVNPAVDPSTGQVRVYVDVPNADGR
FT                   LLAGLYAQGRVASQASEALAAPATAVDATSTPPTVMKVQDGKVQKVAVEIALRDDVAGA
FT                   VGFRSGVKQGDVLVLGSARGALADGTPVRVVEDPRAQQSN"
     atgccgagag ccaccggacc tcgacgcgga tgcaggctgc tcgggctggc gctcgccgcg        60
     gccgtagccc tccccggctg caagcggggc ggcggcagca ccgccgaggc cgcgcaggag       120
     cagccgccgg tcgcgctcgc gccggagaac gtcgcggtgg tgtcgtcccg ccggctccag       180
     tcgggcccgg aggtggccgg caccctgcac gcccgccgca cggccacgct gcgcgccgag       240
     gtgggcggcg cggtcgccga ggtccgcgtc gaggcgggcg agcgggtgaa ggcagggcag       300
     ctcctcgcgc ggatcgacgc ctcggcgctc caggacgcgg tgcgggcggc gcgctccgcg       360
     gtgacctcgg cgcagaacgc gctccgcgtg gcggagtcga gcgcgcggcg cgcccacacc       420
     ctggcccgcg agggcgccat ggccgagcag gacgccgagc gcgccgaggc gcagctcgag       480
     gcggcgcgcg cgcaggtgga ggacgcgaag gcccggctcg ccgcggcgga gcagcaggcc       540
     ggcaagacgg cggtgcgcgc gcccttcgcc ggcgtcgtct cggagcggaa cgtctcgtcg       600
     ggcgacgtgg tgtcctccgg cgccgcgctg tacacggtga tcgacccctc ccgcctccag       660
     ttcgagggct cggtgccggc ggcgagcgtg ggcgcgctcg cgcccggcgc gccggtggac       720
     ttcgcggtga ccggcttcgg cggccgccgc ttcgacgggc acatcgagcg cgtgaacccc       780
     gcggtcgatc ccagcaccgg ccaggtgcgc gtctacgtgg acgtgccgaa cgccgacggc       840
     cggctcctgg ccggcctcta cgcgcagggg cgggtggcga gccaggcgag cgaggccctg       900
     gccgcgccgg cgacggcggt ggacgcgacc tccaccccgc ccacggtcat gaaggtgcag       960
     gacgggaagg tgcagaaggt ggcggtcgag atcgcgctcc gcgacgacgt ggccggtgcg      1020
     gtgggcttcc gctccggcgt gaagcagggc gacgtgctcg tgctcggctc ggcgcgcggt      1080
     gcgctcgccg acggcacccc ggtgcgcgtg gtcgaggatc cgcgcgcgca gcagtcgaac      1140
     tag                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page