(data stored in ACNUC7421 zone)

EMBL: CP000251.PE225

CP000251.PE225       Location/Qualifiers
FT   CDS_pept        255952..259116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0226"
FT                   /product="Acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80003"
FT                   /db_xref="GOA:Q2IMH0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMH0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80003.1"
FT                   /translation="MFISDFAIKRPIVTITVMLALVIFGLLALVTLKTDEFPDVQPPVV
FT                   AVTIVYPGASPETVEREVIDPIEDAIFSISGIDGKQTTASATDGLAQFIVFFDFEKNLM
FT                   EATQDIRDAISSKRQDLPTEMEEPVLVRFDPSQEPIVTLTLTSKTLPVPALTRLADEVV
FT                   SRDLRSVQGVADVRLVGGQKRELTVQLDPEAMAAASVSAAEVVGALQAQNLAAPVGRVN
FT                   TPLGEQSIRLSGRLATPEEFEQVAVASRGGQVVRLGQVAKVLDGAEEARTLALFNSGEA
FT                   VGLEVLKTKGYSTTAVADAVKERARALEPRMEGAKLAVVQDSGTRVRQSVDDVQRTLIE
FT                   GALLTVLVVFLFLNSWRSTVITGLALPVSVLAAFVSVWAFGFTLNTMSLLGLSLAIGIL
FT                   IDDAIVVRENIVRHIELGEDHTTASHKGTDEIGLAVTATTFSIVAVFVPVAFMYGVAGQ
FT                   WFKPFALTIAAAVLVSLFVSFSLDPMMSAYWPDPQVEKGERRGPVGRALGAFNRWFDRQ
FT                   AAGYRRVVAWALDHRWLVVAFATLSLVGSFALQGAFGGAGFVPVSDRSEVSLIVQTPPG
FT                   SSIEYTRRKVEETDRILRSHPEVAYTYASIGTPIPLQAPGVDQALIYARLTPKRERDVS
FT                   QDALGAVLRRELSRVAGAEISVFTSGFGGAFKSIQLELRGPDSRVLTELAEKVKAVAAG
FT                   VPGAVDVGLSTRGQKPELAVEVDRGLAGRLGVTVGQVAQSLRIAFAGLDSGDWVDPTGE
FT                   TRKVMVRLAPEARERASDLRQLPLVLPSREGAPRILPVGQVARITEGLGPAQISHLDRQ
FT                   RVVSVQGNVAGRSLSEVVNDIERRLASELKLPPGYTLRQGGESADQAEVFTRIGVALLL
FT                   AVMLMYLVLVLQFGSFLDPLAILLSLPLSLIGVVLALLVTGDTINLMSLIGVILLFGIV
FT                   AKNAILLIDFAKWAREERGLSIRDALVEAGGIRLRPIMMTSVAVIAGMIPVASGLGEGG
FT                   DFRAPLGRAVIGGVITSTLLTLLVIPTVYEIMDGWRTRLGRLFRRAFSRGGERHAREAA
FT                   QRREEP"
     atgttcatct ccgacttcgc catcaagcgg cccatcgtca ccatcacggt gatgctggcg        60
     ctcgtgatct tcgggctgct ggcgctcgtc acgctcaaga ccgacgagtt cccggacgtc       120
     cagccgccgg tggtggcggt caccatcgtc taccccggcg cctcgcccga gacggtcgag       180
     cgcgaggtga tcgatcccat cgaggacgcg atcttctcga tcagcggcat cgacgggaag       240
     cagaccaccg cctccgccac cgacggcctc gcccagttca tcgtgttctt cgacttcgag       300
     aagaacctga tggaggcgac gcaggacatc cgcgacgcca tcagctcgaa gcgccaggac       360
     ctgcccaccg agatggagga gccggtgctg gtccggttcg atccgtcgca ggagccgatc       420
     gtcacgctca cgctcacctc gaagacgctg ccggtgccgg cgctgacgcg gctcgccgac       480
     gaggtggtct cgcgcgacct gcgctcggtg cagggcgtcg ccgacgtgcg gctggtgggc       540
     gggcagaagc gcgagctcac cgtccagctc gacccggagg cgatggcggc cgccagcgtc       600
     tcggccgccg aggtggtggg cgcgctgcag gcgcagaacc tggccgcgcc ggtggggcgc       660
     gtcaacacgc cgctcggcga gcagagcatc cgcctctccg gccgcctcgc cacgcccgag       720
     gagttcgagc aggtggcggt cgcgagccgc ggcggccagg tggtccgcct gggccaggtg       780
     gcgaaggtgc tcgacggcgc cgaggaggcg cgcacgctcg cgctcttcaa ctcgggcgag       840
     gcggtgggcc tggaggtcct gaagacgaag ggctactcca ccaccgccgt cgccgacgcg       900
     gtgaaggagc gggcgcgggc gctcgagccg cggatggagg gggcgaagct cgccgtcgtc       960
     caggactccg gcacgcgcgt gcgccagtcg gtggacgacg tgcagcggac gctcatcgag      1020
     ggcgcgctcc tcaccgtgct ggtggtgttc ctgttcctca actcgtggcg gtccaccgtc      1080
     atcaccgggc tcgcgctgcc ggtctcggtg ctggcggcgt tcgtgagcgt ctgggcgttc      1140
     ggcttcacgc tcaacaccat gtcgctcctg ggcctctcgc tcgcgatcgg catcctcatc      1200
     gacgacgcca tcgtggtccg cgagaacatc gtccggcaca tcgagctcgg cgaggaccac      1260
     accaccgcct cgcacaaggg gaccgacgag atcggcctgg cggtcaccgc caccaccttc      1320
     tccatcgtgg cggtgttcgt gccggtcgcg ttcatgtacg gggtggccgg ccagtggttc      1380
     aagccgttcg cgctcaccat cgccgcggcg gtgctggtgt cgctgttcgt gtccttctcg      1440
     ctcgacccca tgatgtcggc gtactggccg gatccgcagg tggagaaggg cgagcggcgc      1500
     gggccggtgg ggcgcgcgct gggcgccttc aaccgctggt tcgaccgcca ggccgccggg      1560
     taccgccgcg tggtcgcctg ggcgctcgac caccgctggc tcgtggtggc cttcgccacg      1620
     ctctcgctgg tcggctcgtt cgcgctgcag ggcgcgttcg gcggcgccgg cttcgtgccg      1680
     gtgtcggatc gcagcgaggt gagcctcatc gtgcagacgc cgcccggctc gtccatcgag      1740
     tacacgcggc gcaaggtgga ggagaccgat cgcatcctcc gcagccaccc cgaggtcgcg      1800
     tacacctacg cctcgatcgg cacgcccatc ccgctccagg cgcccggcgt ggaccaggcg      1860
     ctcatctacg cgcggctcac gcccaagcgc gagcgcgacg tctcgcagga cgcgctcggc      1920
     gcggtgctgc ggcgcgagct gtcgcgggtg gccggcgcgg agatctcggt cttcacgagc      1980
     ggcttcggcg gcgcgttcaa gtcgatccag ctcgagctgc gcggccccga ctcgcgggtg      2040
     ctcaccgagc tcgccgagaa ggtgaaggcc gtcgccgccg gcgtgccggg ggccgtggac      2100
     gtggggctct ccacccgcgg gcagaagccg gagctggcgg tcgaggtgga ccgcggcctc      2160
     gccggccggc tcggcgtcac ggtgggccag gtggcgcagt cgctccggat cgcgttcgcc      2220
     gggctcgact ccggcgactg ggtggacccg accggcgaga cgcgcaaggt gatggtgcgg      2280
     ctcgcgcccg aggcgcgcga gcgcgcgtcc gacctgcgcc agctgccgct cgtcctgccg      2340
     agccgcgagg gcgcgccgcg gatcctgccc gtcggccagg tggcgcgcat caccgagggg      2400
     ctcggccccg cgcagatctc gcacctcgac cggcagcgcg tggtgagcgt gcaggggaac      2460
     gtggccggcc gctccctctc cgaggtggtg aacgacatcg agcggaggct cgcctcggag      2520
     ctgaagctgc cgccgggcta cacgctccgg cagggcggcg agtcggcgga ccaggccgag      2580
     gtgttcacgc gcatcggcgt cgcgctgctg ctcgccgtga tgctcatgta cctcgtgctc      2640
     gtgctgcagt tcgggtcgtt cctcgacccg ctcgcgatcc tgctgtcgct gccgctgtcg      2700
     ctcatcggcg tggtgctggc gctgctcgtc accggcgaca ccatcaacct gatgagcctc      2760
     atcggcgtca tcctgctgtt cgggatcgtg gcgaagaacg ccatcctgct catcgacttc      2820
     gcgaagtggg cgcgggagga gcgcgggctg tcgatccgcg acgcgctcgt cgaggccggc      2880
     gggatccgcc tccggccgat catgatgacg agcgtggcgg tgatcgccgg catgatcccg      2940
     gtcgcctccg ggctcggcga gggcggcgac ttccgcgcgc ccctcggtcg cgccgtgatc      3000
     ggcggcgtca tcacctccac gctgctcacg ctgctcgtga tcccgaccgt gtacgagatc      3060
     atggacggct ggcggacccg gctgggccgc ctgttccgcc gggcgttctc gcgcggcggc      3120
     gagcggcacg cccgcgaggc ggcgcagcgg cgggaggagc cctag                      3165
//

If you have problems or comments...

PBIL Back to PBIL home page