(data stored in ACNUC7421 zone)

EMBL: CP000251.PE232

CP000251.PE232       Location/Qualifiers
FT   CDS_pept        265317..265778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0233"
FT                   /product="protein of unknown function DUF163"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80010"
FT                   /db_xref="GOA:Q2IMI1"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IMI1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80010.1"
FT                   /translation="MKIRVVAVGRDRSGLYAPAVDEYAKRLGRYLRFELVEVPEARKLA
FT                   GTPGAKGEEGAALLAKLGPRERVVVLDERGDELTSVAFAERVRRWMERGQDVALLIGGS
FT                   DGLAPEVLARAEERLAVSRFTLAHRLARLVLVEQLYRAMTILRGEPYHK"
     gtgaagatcc gggtggtggc ggtgggccgg gatcgctcgg gcctgtacgc gccggccgtg        60
     gacgagtacg cgaagcggct cggccgctac ctgcgcttcg agctggtgga ggtgccggag       120
     gcgcgcaagc tcgccggcac cccgggggcg aagggcgagg agggcgcggc gctcctcgcg       180
     aagctcgggc cgcgcgagcg ggtggtggtg ctcgacgagc gcggcgacga gctcaccagc       240
     gtggcgttcg ccgagcgcgt gcgccgctgg atggagcgcg gccaggacgt ggcgctcctc       300
     atcggcgggt cggacgggct cgcgccggag gtgctggcgc gggccgaaga gcgcctcgcg       360
     gtgtcgcgct tcacgctggc gcaccggctg gcgcggctcg tgctcgtcga gcagctctac       420
     cgcgccatga ccatcctccg cggcgagccc taccacaagt ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page