(data stored in ACNUC7421 zone)

EMBL: CP000251.PE236

CP000251.PE236       Location/Qualifiers
FT   CDS_pept        270946..274716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0237"
FT                   /product="tetratricopeptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80014"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024618"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMI2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80014.1"
FT                   /translation="MLARPAALLALCLASTGSARAPSPLPPPTGLDPDAERAAAAVAAL
FT                   DRERRGPRGLAALAELDALADDLPELAHVAAAYARAADDREAHPEVRALARFRLAEVER
FT                   ARGNLQKEAASLRRLGFVERWRVIGPFDDEGKRGLAEAFPPEKAIDLAARHPGKAREVA
FT                   WRALPEDAVVDGFVHLGAALRPAREVVAYALAEVEAPRELEARLWLGASGAARVWVNGA
FT                   AVLTDADYHPARLDQRGVVVTLRRGANRILVKLCHQDGRMGFYLRLADARGEGLELAAA
FT                   DPRGAALREVPAPGPAAPIAPAVGALEQRAKAARGARAEAEARLELARVLAARQGGDVQ
FT                   ERRAAAEARRAALLAPGWADAQLEAAALDEDHGRRRQRIEAALAAAPEDPRALRALGQE
FT                   ELDQGRPQAAARLLERAVRAAPGWAAPRVELADALSRAGLEARGALLAEATAAAFATVP
FT                   SAVRAAARSARRLGRTEEAAARSRTLVALRFDDAQTRAALAQILADRGDVAGAQALLEE
FT                   ALRLDPSDVYQRLRLADLLAASGRGEEAERAYAAALALAPDEPDAWERRGRARLSQGRV
FT                   KDAQADLQRALELRPQSPELKLLVRSLEPAREPFERPYLLDARELAAAAPAAEPDEDAL
FT                   VLGELKVTRVLPSGLSSTYTQSVVKVLTPRGADQARRQTVSWAPDRQEVRVERARILKP
FT                   DGTVIEAHDESERSASEPWYRLYYDLTARTLSFPALAPGDVLEVAWRLEDVAGENLLSD
FT                   YFGDLTFVDDTTRKARFDYVLLVPAARAIHANAPAGIAHAQRALPGDVVEHRWSARDLP
FT                   RVVPEPGMPGWSEVSRHVHVSTYASWDQVARFYWGLVKDAVRPTPEVRAEAERIAAEVL
FT                   RARRGDGTRVARAQAAASTLPPPGGWDLETQRALTRAVYDFVVSQTRYVGLEFGIHGYK
FT                   PYRVDQVLQRRFGDCKDKASLLRAMLESIGIDARLVLLRMRRLGRLPEAPASLAVFNHA
FT                   IVYVPALDLWLDGTAAYSGSGDLPGEDRGATVLVVNPDGKPRFATVPEALPEQNRGETR
FT                   FDVAIAADGAASVRGAWRVSGAEAPTYRRAYLVEEQRRAQLEQTFNRSFPGVRVASVTA
FT                   SDLTRLEDDVTMQFALEIPRFARPDGAGLRFSPFGATRGWGESWAALSSRWHDLDLGSP
FT                   TETVFTYRYTLPAGWRIAELPDGDAARTPYASFDVRYRRDGAALVAEARVRLEKGRIPA
FT                   RDYPAFRELTGRIDRAFARKVRIVPAQEAAR"
     atgctcgcac gccccgccgc cctgctcgcg ctctgcctcg cctcgacggg gtccgcccgc        60
     gcgccgtccc cgctcccgcc gcccaccggc ctcgacccgg acgcggagcg ggccgccgcg       120
     gccgtggcgg cgctcgaccg cgagcggcgc ggcccccgcg gcctcgccgc gctcgccgag       180
     ctggacgcgc tcgccgacga cctgcccgag ctcgcccacg tcgccgccgc ctacgcgcgc       240
     gccgccgacg atcgcgaggc gcacccggag gtccgcgcgc tggcgcgctt ccggctcgcc       300
     gaggtggagc gcgcccgggg caacctgcag aaggaggcgg ccagcctgcg ccggctgggg       360
     ttcgtcgagc gctggcgggt gatcgggccg ttcgacgacg aggggaagcg cggcctcgcc       420
     gaggcgttcc cgcccgagaa ggccatcgac ctcgccgccc gccacccggg aaaggcgcgc       480
     gaggtggcct ggcgcgcgct gccggaggac gcggtggtgg acggcttcgt gcacctgggc       540
     gcggcgctcc gcccggcgcg cgaggtggtg gcgtacgcgc tcgccgaggt cgaggcgccc       600
     cgcgagctcg aggcccggct ctggctcggc gcgagcggcg cggcgcgggt gtgggtgaac       660
     ggcgcggccg tgctcaccga cgcggactac cacccggccc ggctcgatca gcgcggcgtg       720
     gtggtgacgc tccggcgcgg cgcgaaccgg atcctggtga agctctgcca ccaggacggc       780
     cgcatggggt tctacctccg gctcgccgac gcgcgcggcg aggggctgga gctcgcagcg       840
     gccgatccgc ggggcgccgc gctgcgggag gtccccgccc ccgggcccgc ggcgccgatc       900
     gcgcccgcgg tgggcgcgct cgaacagcgc gcgaaggcgg cccgcggcgc gcgcgccgag       960
     gcggaggccc ggctcgagct ggcgcgggtg ctggcggcgc ggcagggcgg cgacgtgcag      1020
     gagcggcggg cggcggccga ggcgcggcgc gccgcgctgc tcgcgcccgg ctgggcggac      1080
     gcgcagctcg aggcggcggc gctcgacgag gaccacgggc gccggcggca gcgcatcgag      1140
     gccgcgctcg cggcggcgcc ggaggacccg agggcgctgc gggcgctcgg acaggaggag      1200
     ctggaccagg gccggccgca ggcggcggcc cggctgctgg agcgggcggt gcgggccgcg      1260
     ccgggctggg cggcgccgcg ggtggagctc gccgacgcgc tctcccgcgc cggcctggag      1320
     gcgcgcggcg cgctgctcgc ggaggcgacc gcggcggcgt tcgccaccgt gccctccgcg      1380
     gtgcgggccg cggcgcggtc cgcgcggcgc ctcgggcgca ccgaggaggc ggcggcgcgc      1440
     agccgcacgc tggtggcgct ccggttcgac gacgcgcaga cgcgcgccgc gctggcgcag      1500
     atcctggccg accgcggcga cgtggccggc gcgcaggcgc tgctcgagga ggcgctgcgg      1560
     ctcgacccct ccgacgtgta ccagcggctg cggctcgccg acctgctcgc ggcgagcggc      1620
     cgcggcgagg aggcggagcg cgcctacgcc gcggcgctcg cgctcgcgcc ggacgagccg      1680
     gacgcctggg agcggcgcgg ccgcgcgcgg ctctcgcagg gccgggtgaa ggacgcgcag      1740
     gccgacctgc agcgcgcgct cgagctccgg ccgcagagcc cggagctgaa gctgctggtg      1800
     cgcagcctcg agccggcgcg cgagccgttc gagcggccgt acctgctcga cgcgcgcgag      1860
     ctggccgcgg ccgcccccgc ggcggagccg gacgaggacg ccctggtgct gggcgagctg      1920
     aaggtcaccc gcgtgctgcc ctcggggctc tcctccacgt acacgcagtc ggtggtgaag      1980
     gtgctgacgc cccgcggcgc cgaccaggcg cgccggcaga ccgtgtcctg ggcgccggac      2040
     cggcaggagg tgcgcgtgga gcgcgcgcgc atcctgaagc cggacgggac ggtgatcgag      2100
     gcgcacgacg agtccgagcg gagcgcgagc gagccctggt accggctcta ctacgacctc      2160
     accgcccgca cgctgtcgtt cccggcgctc gcgcccggcg acgtgctgga ggtggcctgg      2220
     cggctcgagg acgtcgccgg ggagaacctg ctctccgact acttcggcga cctcacgttc      2280
     gtggacgaca ccacccgcaa ggcgcgcttc gactacgtgc tgctcgtccc ggcggcgcgc      2340
     gccatccacg cgaacgcgcc ggccgggatc gcgcacgcgc agcgcgcgct cccgggagac      2400
     gtggtggagc accgctggtc cgcgcgcgac ctgccccgcg tcgtgcccga gccgggcatg      2460
     ccgggctgga gcgaggtgtc gcgccacgtg cacgtctcca cgtacgcgag ctgggaccag      2520
     gtggcccgct tctactgggg gctggtgaag gacgcggtgc gccccacccc cgaggtgcgc      2580
     gccgaggcgg agcggatcgc ggccgaggtg ctgcgcgccc ggcgcggcga cggcacgcgc      2640
     gtggcgcggg cgcaggccgc ggcgagcacg ctgccgccgc ccggcggctg ggacctcgag      2700
     acgcagcgcg cgctcacccg cgccgtctac gacttcgtgg tctcgcagac ccgctacgtg      2760
     gggctggagt tcggcatcca cggctacaag ccgtaccggg tggaccaggt gctgcagcgc      2820
     cgcttcggcg actgcaagga caaggcgagc ctgctgcgcg ccatgctgga gtcgatcggg      2880
     atcgacgcgc gcctggtgct gctgcgcatg cggcggctgg gccggctccc cgaggcgccg      2940
     gcctccctcg ccgtgttcaa ccacgccatc gtgtacgtgc ccgcgctcga cctgtggctg      3000
     gacggcaccg ccgcctactc cggctcgggc gacctgcccg gcgaggaccg tggcgccacg      3060
     gtgctggtgg tgaatccgga cggcaagccg cgcttcgcca ccgtgccgga ggcgctcccc      3120
     gagcagaacc gcggcgagac ccgcttcgac gtggcgatcg ccgcggacgg tgcggcctcg      3180
     gtccgcggcg cctggcgcgt gagcggcgcg gaggcgccga cctaccgccg cgcctacctg      3240
     gtggaggagc agcggcgcgc ccagctggag cagaccttca accgcagctt ccccggcgtg      3300
     cgcgtcgcct cggtgacggc ctccgatctc acccgcctcg aggacgacgt caccatgcag      3360
     ttcgcgctgg agatcccccg cttcgcccgg cccgacggcg cgggcctgcg cttctccccg      3420
     ttcggcgcca cgcgcggctg gggcgagagc tgggccgcgc tctcctcgcg ctggcacgac      3480
     ctcgacctgg gcagccccac cgagacggtg ttcacctacc ggtacacgct gccggccggc      3540
     tggcggatcg ccgagctgcc cgacggcgac gccgccagga ccccctacgc cagcttcgac      3600
     gtgcgctacc gccgcgacgg cgcggcgctg gtcgccgagg cccgcgtgcg gctggagaag      3660
     gggcgcatcc cggcccgcga ctaccccgcg ttccgcgagc tgaccgggcg catcgaccgc      3720
     gccttcgcgc gcaaggtgcg catcgtcccc gcccaggagg ccgcccgatg a               3771
//

If you have problems or comments...

PBIL Back to PBIL home page