(data stored in ACNUC7421 zone)

EMBL: CP000251.PE237

CP000251.PE237       Location/Qualifiers
FT   CDS_pept        274713..278432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80015"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR024618"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMI4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80015.1"
FT                   /translation="MSRAARRGPPRIPGVAAALAALALACAAPRAEQAEPGRATREGLA
FT                   ALEQNDVARAEARLGPASRVRDPWARFGASLLARRALDGEAEAQRLLATVEAGPDEPIA
FT                   LVALRRLSELAERGPALAAQVDAGVLRLGAGGRLHGLAAYRARVARVTAAEVLGDHDAA
FT                   AQARRENGAVSAWSIAGPFAAHHALDFGAPIPPDRGELPASVPGRAGGPAVPTRALPAP
FT                   DGTVALDGEPAAGDLFALATDVDLARGGRYLVTLGTQLSARLVVDGALVHERRAFAAWL
FT                   PGLVHLPVELARGRHRVVLEVTRGAPSTGIHLAFARADGAASDARFAAPPPGPPPAPPV
FT                   ARPRAEPALTPRALALALEPDVGAATARLLAARDALVNDREAAKVLLAEALALRPEAAA
FT                   LRAARADATADDPTLDEQVARARAEADLREALRLDPGDAEARAELAALLRGAERHDDAE
FT                   AVLAGLAPEPAARPAGIAARARAAQARGLLERAEGLAAEALRSAGSCDAADLAYELAVR
FT                   RGAAAREDEAMAVLSRCRGGRERLAAHLRRRGDPVAERAALDPVVRARPWAVEPGLTRA
FT                   DALVAAGETRRATAALEAIAAIWPRDARVQRRLADARELSGDAPGARAARERALALDPA
FT                   DLQLRRALALEDGTEVLADVAADPRAAIRAYEAAGRRNGASTVMVLDAAYVDVHPGGAA
FT                   TERTQQIVHVLDQQGVEQFGEVTVPAGADVLALRTVKPDGTTLEPERAGSAKGSVSLAG
FT                   LAPGDYVELDYVRAVQSPPGLEGYAADPFYFQVPGSRLFRSLYVVRAPAGLGLEADAHG
FT                   MPAPAPVRDGGREVLRAERRDVPAIVPEPDAPGGAEYLPFLSVGTGGGRAALQRAVADA
FT                   LPERTRATAELRAFAREIAAGGGGPAQLARAAYARVAQAVLGSGGGMGEDASVALSRGR
FT                   GSRLAVLKAVLAELGIESRVALVRPYSADPAPYRFPALGLYAAPLLRVRAGGATFWLDP
FT                   TARHAPFGAFPAVLAGCEALVLPEAGEAPEVDRTPESPLVEEGRETTARLVLAADGSAE
FT                   ASGTDRYLGYGGAELKAALERLDASQRRQAVEGMLGRVLRGVTVTDVAFAGEDDPAAPL
FT                   EIRWKARVPELARAVEGGLVLDQPLFPARLGARLVRVASRQTPLLLATPERQVQRIEVV
FT                   PPRGLGVTADAPRTASSPSGSFTRTERVDGGTLVRDERLELRRGRIAPEHHAELAAFAA
FT                   AVDQAQERPLLLAR"
     atgagccgcg ccgcgcgccg agggccgccg cggatcccgg gggtcgccgc cgcgctggcg        60
     gcgctcgcgc tcgcctgcgc cgccccgcgc gccgagcagg ccgagcccgg gcgcgccacg       120
     cgcgagggcc tggccgcgct ggagcagaac gacgtcgccc gcgccgaggc gcggctcggc       180
     ccggcctcgc gggtccggga cccctgggcg cggttcggcg cgtcgctgct cgcgcggcgc       240
     gcgctcgacg gcgaggcgga ggcgcagcgg ctgctcgcga ccgtggaggc cgggccggac       300
     gagcccatcg ccctggtcgc gctgcggcgg ctctccgagc tggccgagcg ggggccggcg       360
     ctggcggccc aggtggacgc gggcgtcctg cggctcgggg cgggcggccg gctgcacggg       420
     ctcgccgcct accgggcgcg ggtggcgcgg gtgaccgcgg ccgaggtgct cggcgatcac       480
     gacgccgccg cccaggcccg ccgcgagaac ggcgcggtct cggcctggtc catcgcgggg       540
     ccgttcgcgg cgcaccacgc gctcgacttc ggcgcgccca tcccgcccga tcgcggcgag       600
     ctgcccgcgt cggtgccggg ccgcgccggc gggcccgcgg tcccgacccg cgcgctcccc       660
     gcgcccgacg gcaccgtcgc gctcgacggc gagccggcgg ccggcgacct gttcgcgctc       720
     gccaccgacg tggacctggc ccgcggcggc cgctacctcg tgacgctcgg gacgcagctc       780
     tcggcccgcc tggtcgtgga cggcgcgctg gtgcacgagc ggcgcgcgtt cgcggcctgg       840
     ctcccggggc tggtgcacct gccggtggag ctcgcgcgcg gccggcaccg ggtggtgctg       900
     gaggtgaccc gcggcgcgcc gagcaccggg atccacctcg ccttcgcgcg cgccgacggg       960
     gccgcctccg acgcccgctt cgcggcgccg ccgccgggcc cgccgcccgc gccgccggtg      1020
     gcgcggcccc gcgccgagcc ggcgctgacc ccgcgggcgc tggcgctcgc gctcgagccg      1080
     gacgtcgggg cggccaccgc gcgcctgctg gcggcgcgcg acgccctggt gaacgaccgc      1140
     gaggcggcca aggtgctcct cgccgaggcg ctggccctgc ggcccgaggc ggcggcgctc      1200
     cgcgcggcgc gcgcggacgc gaccgccgac gaccccacgc tcgacgagca ggtggcgcgg      1260
     gcgcgcgccg aggccgacct gcgggaggcg ctgcgcctcg acccgggcga cgccgaggcg      1320
     cgcgcggagc tggcggcgct cctgcgcggc gccgagcgcc acgacgacgc cgaggcggtg      1380
     ctggccggcc tcgccccgga gccggccgcg cggcccgccg ggatcgccgc ccgggcgcgc      1440
     gcggcgcagg cccgcgggct gctggagcgc gccgaggggc tggccgcgga ggcgctccgc      1500
     tcggcgggga gctgcgacgc ggccgatctc gcgtacgagc tggcggtccg gcgcggcgcc      1560
     gccgcccgcg aggacgaggc catggcggtg ctctcgcgct gccgcggcgg ccgcgagcgc      1620
     ctggcggccc acctgcgccg ccggggcgac ccggtggcgg agcgcgccgc gctcgacccg      1680
     gtggtgcgcg cccggccctg ggcggtcgag ccgggcctga cccgcgccga cgcgctcgtc      1740
     gccgccggcg agacccgccg cgcgaccgcg gcgctggagg ccatcgccgc gatctggccg      1800
     cgcgacgcgc gcgtgcagcg gcggctcgcc gacgcgcgcg agctgtccgg ggacgcgccc      1860
     ggcgcccgcg ccgcgcgcga gcgggcgctg gcgctcgacc cggccgacct gcagctccgg      1920
     cgcgcgctcg ccctggagga cgggaccgag gtgctcgccg acgtggcggc ggacccgcgc      1980
     gcggccatcc gcgcctacga ggccgccggc cggcgcaacg gcgcgtccac cgtgatggtg      2040
     ctcgacgccg cctacgtgga cgtccacccg ggcggcgccg ccaccgagcg cacgcagcag      2100
     atcgtccacg tgctcgacca gcagggcgtg gagcagttcg gcgaggtcac cgtgcccgcc      2160
     ggcgcggacg tgctcgcgct ccgcaccgtc aagcccgacg ggaccacgct ggagccggag      2220
     cgggcgggga gcgccaaggg ctcggtctcg ctcgccggcc tcgcgcccgg cgactacgtg      2280
     gagctcgact acgtccgcgc ggtgcagtcg ccgcccgggc tggagggcta cgccgccgat      2340
     cccttctact tccaggtgcc cggcagccgg ctgttccggt cgctctacgt ggtgcgcgcg      2400
     ccggcgggcc tcggcctcga ggccgacgcg cacggcatgc cggcgcccgc gccggtgcgg      2460
     gacggcgggc gcgaggtgct ccgggccgag cggcgcgacg tgcccgcgat cgtcccggag      2520
     ccggacgcgc ccggcggcgc cgagtacctg ccgttcctgt cggtggggac cgggggcggg      2580
     cgcgcggcgc tgcagcgcgc cgtcgccgac gcgctgccgg agcgcacccg cgccaccgcc      2640
     gagctccgcg cgttcgcgcg cgagatcgcg gccggcggcg gcgggccggc ccagctggcg      2700
     cgcgccgcct acgcccgcgt ggcgcaggcg gtgctcggct cgggcggcgg catgggcgag      2760
     gacgcgagcg tggcgctgtc gcgcggccgg ggcagccggc tggcggtgct gaaggcggtg      2820
     ctcgccgagc tcggcatcga gtcgcgcgtc gcgctggtgc ggccgtacag cgccgacccg      2880
     gcgccctacc ggttcccggc gctcggcctc tacgccgcgc cgctgctccg cgtgcgcgcg      2940
     ggcggcgcga cgttctggct cgatcccacc gcccgccacg cgccgttcgg cgcgttcccg      3000
     gcggtgctgg ccgggtgcga ggcgctcgtc cttcccgagg cgggcgaggc gccggaggtg      3060
     gaccggacgc cggagagccc gctcgtggag gagggccggg agaccaccgc gcgcctcgtg      3120
     ctcgcggccg acggctccgc cgaggcgagc ggaaccgatc gctacctcgg gtacgggggc      3180
     gcggagctga aggccgcgct cgagcgcctc gacgcctcgc agcgccgcca ggcggtggag      3240
     gggatgctgg ggcgggtgct gcgcggcgtg accgtgaccg acgtcgcgtt cgcgggcgag      3300
     gacgatcccg cggcgccgct cgagatccgc tggaaggcgc gggtgccgga gctggcccgg      3360
     gcggtggagg gcgggctggt cctggaccag ccgctcttcc cggcgcggct cggcgcgcgc      3420
     ctggtgcgcg tcgcctcccg ccagacgccg ctcctgctgg ccacgcccga gcggcaggtg      3480
     cagcggatcg aggtggtgcc gccgcgcggc ctcggcgtga ccgccgacgc gccccgcacc      3540
     gcgtcgtcgc cgtcgggcag cttcacgcgc acggagcggg tggacggggg aacgctcgtc      3600
     cgcgacgagc gcctggagct gcgccgcgga cgcatcgcgc cggagcacca tgccgagctg      3660
     gccgcgttcg cggccgcggt ggaccaggcg caggagcggc cgctgctcct cgcgcgctga      3720
//

If you have problems or comments...

PBIL Back to PBIL home page