(data stored in ACNUC7421 zone)

EMBL: CP000251.PE247

CP000251.PE247       Location/Qualifiers
FT   CDS_pept        290570..293074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0249"
FT                   /product="PBS lyase HEAT-like repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80025"
FT                   /db_xref="GOA:Q2IMI9"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMI9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80025.1"
FT                   /translation="MRRDLAQLLVEEGAIPAAAAERAAARQAEAGGALDTALLELGLAG
FT                   EDVVLRALERASGLPAAPDWAWDASDARARRVFPSRVAERHGLAPFALDGRELSLVATH
FT                   PVDLALLDEISFMLSLHLTPHVGPEWRVRALIHRLYGGALPPRLAALAAGGAAAATPGE
FT                   EAASPEPAVAAPDADAPEPDAPPTPEPDPAPPAPASSGPAAAAFDDAAPLEPLAAAVAQ
FT                   VLESADFSFLDAPPATPSPAPAGAAHPAPSARPSAGSGPADAPGAPRGERAESPPEPAP
FT                   RPAPRRMGETAAPPPAPAPGAPGRWTRAEAQAALAAASERDEVLRVVLRYAREFFAFAA
FT                   VFAVSRDAVAGHDALGEEEGEDARALCRSVAIYTSDPGVFHTAIETHAPHLGPISPEPD
FT                   GNRAILDGLGRGTPRTVLVHPVVLRQRTACLLYADNGPAAVSPRRLADLVLFLAGLAPA
FT                   LERVIQARKRARGAAAGEAPAAPPAPPPPEAAPVPVPSPSPARAAAPPRPTPAPVAAPS
FT                   AEPWQAHEPAAALADLEVDIDLFEEELGAAAPPSGAVRFDPEAEVTALLETDPGSLDRI
FT                   AGLARLAAFPEAALPVVWARLPGPIESDDDGASPTALGPLAAALAALGPAAVPAMVEVL
FT                   RDRDPVRRRIAATVLGAAGDPSTFPALAERVLDADPRVAGAAIAALAAHRRHPEMRAVP
FT                   EKLRRALLSGVAARTTFAARALGALRDAESVPLLVQVLESSEREPAEAAAAALAEITLQ
FT                   RLGTDPRRWLAWWKQNRGRGRAEWLLSGLTSAEREVRAAAAEELARAAPPPVSYQVDAP
FT                   AAEREAAARLWAGWWARSGLVL"
     gtgcggaggg acctggcgca gctcttggtg gaggagggcg cgatccccgc cgccgcggcg        60
     gagcgcgcgg ccgcgcgcca ggccgaggcc ggcggcgcgc tcgacaccgc gctgctcgag       120
     ctgggcctcg ccggcgagga cgtggtcctc cgcgcgctgg agcgcgccag cggcctcccg       180
     gccgcgccgg actgggcgtg ggacgcctcc gacgcgcggg cgcggcgggt gttcccctcg       240
     cgcgtcgccg agcgccacgg cctcgcgccg ttcgcgctcg acggccggga gctctcgctc       300
     gtcgccaccc acccggtgga cctggcgctg ctcgacgaga tcagcttcat gctctcgctg       360
     cacctcaccc cgcacgtcgg gccggagtgg cgggtgcgcg cgctcatcca ccgcctgtac       420
     ggcggcgcgc tcccgccgcg gctcgccgcg ctcgcggcgg gcggcgccgc ggccgcgacc       480
     ccgggcgagg aggcggcctc gccggagccg gccgtcgccg cgccggacgc ggacgcgccg       540
     gagccggacg cgccgccgac gccggaaccc gatcccgcgc cgcccgcgcc ggcgagctcg       600
     gggccggcgg ccgcggcctt cgacgacgcg gcgccgctcg agccgctcgc ggccgcggtg       660
     gcgcaggtgc tcgagtcggc ggacttctcc ttcctcgacg cgccgcccgc gaccccgtcg       720
     cccgcgccgg ccggcgccgc ccatcccgct ccgtccgcgc gtccctcggc gggctcggga       780
     ccagcggacg ctccgggggc gcctcgcggt gagcgcgccg agtcgccgcc ggagcctgcc       840
     ccccgccccg cgccgcggcg catgggcgag acggccgcgc cgcctcctgc gcccgccccc       900
     ggcgcgccgg gccgctggac gcgggcggag gcgcaggccg cgctcgccgc cgcgtcggag       960
     cgcgacgagg tgctgcgcgt cgtgctgcgc tacgcgcgcg agttcttcgc gttcgcggcg      1020
     gtgttcgcgg tctcgcgcga cgcggtggcg ggccacgacg cgctcggcga ggaggagggc      1080
     gaggacgcgc gcgcgctgtg ccgctcggtc gccatctaca cgagcgatcc gggcgtgttc      1140
     cacaccgcca tcgagaccca cgcgccgcac ctcgggccca tctcgcccga gccggacggg      1200
     aaccgcgcca tcctcgacgg cctggggcgc gggacgccgc gcaccgtgct cgtccacccg      1260
     gtggtgctgc gccagcgcac cgcctgcctg ctctacgccg acaacggccc ggcggcggtc      1320
     tcgccgcgcc gcctcgccga cctggtgctg ttcctggcgg gcctggcccc ggcgctcgag      1380
     cgcgtcatcc aggcgcgcaa gcgcgcccgc ggcgccgccg ccggcgaggc ccccgccgcc      1440
     ccgccggccc cgccgccgcc ggaggccgcg cccgtcccgg tgccgtcgcc gtcgccagcc      1500
     cgcgccgccg cgccgcccag gcccaccccg gcgcccgttg cggcgccgtc cgccgagccg      1560
     tggcaggcgc acgagcccgc cgccgcgctc gcggatctcg aggtggacat cgacctcttc      1620
     gaggaggagc tcggggcggc ggcgccgccc tcgggcgcgg tgcggttcga tccggaggcg      1680
     gaggtcaccg cgctgctcga gaccgacccc ggctcgctcg accggatcgc cgggctcgcc      1740
     cgcctggcgg cgttcccgga ggcggcgctc ccggtggtgt gggcgcgcct gcccgggccg      1800
     atcgagtccg acgacgacgg cgcctcgccc accgcgctcg gcccgctcgc cgcggcgctc      1860
     gcggcgctcg gccctgcggc ggtgccggcc atggtggagg tgctccgcga ccgcgacccg      1920
     gtccggcggc gcatcgcggc cacggtgctc ggcgcggcgg gcgacccgtc caccttcccg      1980
     gcgctcgcgg agcgggtgct cgacgcggac ccgcgcgtcg ccggcgccgc catcgccgcg      2040
     ctcgcggcgc accgccgcca ccccgagatg cgcgcggtcc cggagaagct ccgccgcgcg      2100
     ctgctctccg gggtggccgc gcggaccacg ttcgccgccc gggcgctcgg cgcgctgcgc      2160
     gacgccgagt cggtgccgct cctggtccag gtgctggaga gctcggagcg cgagccggcc      2220
     gaggccgccg ccgcggcgct cgccgagatc accctgcagc ggctcggcac cgacccgcgg      2280
     cgctggctgg cctggtggaa gcagaaccgc gggcgcggcc gcgccgagtg gctgctgtcc      2340
     gggctgacca gcgccgagcg cgaggtgcgc gccgcggccg ccgaggagct ggcccgcgcc      2400
     gccccgccgc cggtgagcta ccaggtggac gcgcccgccg ccgagcgcga ggcggccgcg      2460
     cggctctggg ccggctggtg ggcgcgctcc ggcctggtgc tgtag                      2505
//

If you have problems or comments...

PBIL Back to PBIL home page