(data stored in ACNUC7421 zone)

EMBL: CP000251.PE249

CP000251.PE249       Location/Qualifiers
FT   CDS_pept        complement(295094..295750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80027"
FT                   /db_xref="GOA:Q2IMJ7"
FT                   /db_xref="InterPro:IPR019251"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMJ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80027.1"
FT                   /translation="MPMRTHELHPSIVHAPLALLPAAAIADLVATARPRDRGLDAVGRT
FT                   LWWSAAAGGLAAGLAGMAASQEIEVRSEHARDAMFLHGIGNLGLVLAAFGVAAWRSRNR
FT                   ACLTTALTGLAATAAAGYTAYLGGELVYGHGAGVRAMGGAASEAPPLFSAEAPGRLARD
FT                   AVRGLRWLLSRGARAVTGRERVDRTALGPLAEAGTGAEPPPPGARTDGGLGASPM"
     atgccgatgc gcacgcacga gctgcacccg tcgatcgtcc acgcgccgct ggcgctcctg        60
     ccggcggccg ccatcgcgga cctcgtggcg accgcgcggc cgcgcgaccg gggcctcgac       120
     gcggtcgggc gcacgctgtg gtggtccgcg gcggcgggcg ggctcgccgc cgggctcgcc       180
     gggatggccg cgtcgcagga gatcgaggtc cgcagcgagc acgcccgcga cgccatgttc       240
     ctgcacggca tcggcaacct cggcctggtg ctcgccgcgt tcggcgtcgc ggcctggcgc       300
     agccggaacc gggcgtgcct caccaccgcg ctcaccgggc tggccgcgac cgcggccgcg       360
     ggctacaccg cctacctggg cggcgagctc gtctacggcc acggcgccgg cgtgcgggcc       420
     atgggcggcg ccgcgagcga ggcgccgccg ctgttttcgg ccgaggcgcc cggccggctc       480
     gcccgcgacg cggtccgcgg cctgcgctgg ctgctctcgc gcggcgcgcg cgccgtcacc       540
     ggccgcgagc gggtggaccg caccgcgctc ggcccgctcg ccgaggccgg caccggcgcc       600
     gagccgccgc cgcccggcgc gcgcaccgac ggcgggctgg gcgcctcgcc gatgtga          657
//

If you have problems or comments...

PBIL Back to PBIL home page