(data stored in ACNUC7421 zone)

EMBL: CP000251.PE25

CP000251.PE25        Location/Qualifiers
FT   CDS_pept        complement(28777..29313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79803"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILX1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79803.1"
FT                   /translation="MYLSSRAATVVAAALLTACAGARRAEAPPAALTARELTIVDAQGR
FT                   PRLRLGAPLPPPKGAERRAVDAFGIQFMDSDGYEVAGLGMLEPVDIRGLCFDIKDAYEA
FT                   MCVGLVKGEPSITFRHDWKERITMGVEQGVASIVLHDAQASPRIRLEVDRDGKTRVEGV
FT                   STTSPTPPASGSAAP"
     ttgtacctct catcccgagc cgccaccgtc gtcgccgccg ccctcctcac cgcctgcgcc        60
     ggcgcccggc gcgccgaggc gccgcccgcg gcgctcaccg ctcgcgagct caccatcgtg       120
     gacgcgcagg gccgcccgcg gctgcgcctc ggcgcgccgc tgccaccgcc caagggcgcc       180
     gagcgccgcg cggtggacgc gttcgggatc cagttcatgg actcggacgg ctacgaggtc       240
     gccgggctcg gcatgctcga gccggtggac atccgcggcc tctgcttcga catcaaggac       300
     gcctacgagg cgatgtgcgt cgggctcgtg aagggcgagc cgagcatcac cttccgccac       360
     gactggaagg agcggatcac gatgggcgtg gagcagggcg tcgcgagcat cgtgctgcac       420
     gacgcgcaag caagcccgcg catccgcctc gaggtggacc gcgacgggaa gacgcgcgtc       480
     gagggcgtca gtacgacttc gcccacacca cccgcttcgg gctcggctgc cccgtga          537
//

If you have problems or comments...

PBIL Back to PBIL home page