(data stored in ACNUC7421 zone)

EMBL: CP000251.PE250

CP000251.PE250       Location/Qualifiers
FT   CDS_pept        complement(295938..296141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0252"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80028"
FT                   /db_xref="GOA:Q2IMJ6"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMJ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80028.1"
FT                   /translation="MATGTVKWFNDAKGFGFITQDDGGEDVFCHYSAISGDGFKSLAEG
FT                   QKVEFDVVKGPKGLQAANVRKV"
     atggcgaccg gtaccgtgaa gtggttcaac gacgcgaagg gcttcggctt catcacccag        60
     gacgacggtg gcgaggacgt gttctgccac tacagcgcga tctcgggcga cggcttcaag       120
     agcctggccg aggggcagaa ggtggagttc gacgtggtga aggggccgaa gggcctccag       180
     gccgcgaacg tccgcaaggt gtag                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page