(data stored in ACNUC7421 zone)

EMBL: CP000251.PE256

CP000251.PE256       Location/Qualifiers
FT   CDS_pept        303483..303995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0258"
FT                   /product="biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80034"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMJ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80034.1"
FT                   /translation="MKTYVALLDGGKREVTVGVTRLATGQYEVRVGDEVHRVDAYAHDY
FT                   GTLSLLVDTRSYSAMLDDRGAKVHVQVDGSVFPLELLDERKLRMRRASPRASVEGRRAV
FT                   TAPMPGRVVKVLVAPGDAVRAGQPLVVVEAMKMENEMRSPKDGKVVEVRVVEGQAVEGS
FT                   ALLCAVE"
     atgaagacct acgtggcgct gctcgacggc ggcaagcgcg aggtgacggt gggggtcacg        60
     cggctcgcca ccgggcagta cgaggtgcgc gtcggggacg aggtgcaccg ggtggacgcg       120
     tacgcgcacg actacggcac gctgtcgctg ctcgtggaca cgcgcagcta ctcggccatg       180
     ctcgacgacc gcggcgcgaa ggtgcacgtg caggtggacg ggtcggtgtt cccgctcgag       240
     ctcctcgacg agcggaagct gcgcatgcgg cgggcctcgc cgcgcgcgag cgtggagggc       300
     cggcgggcgg tgaccgcgcc gatgccgggg cgggtggtga aggtgctggt ggcgccgggc       360
     gacgcggtgc gggccggcca gccgctggtg gtcgtcgagg cgatgaagat ggagaacgag       420
     atgaggagcc cgaaggacgg caaggtggtc gaggttcgcg tcgtcgaggg ccaggcggtc       480
     gagggcagcg cgttgctctg cgcggtggag tag                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page