(data stored in ACNUC7421 zone)

EMBL: CP000251.PE258

CP000251.PE258       Location/Qualifiers
FT   CDS_pept        305724..307541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0260"
FT                   /product="DnaJ like heat shock protein with
FT                   tetratricopeptide repeats"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80036"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMK5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80036.1"
FT                   /translation="MSDAPPKPPGETPPPRTRPDVPAGPPRLERVPDGYRPPAVPRAAA
FT                   PAARPPPPPPPAPTYGLAAREVGADAAIAAGLAHQGALAADSALRLYGLAAATRASGRL
FT                   TLAPEGRSYALVFRRGAVEHAASSDPADDLGRFLLRKGVLRPEQLVEAEAARAAAGGDL
FT                   AAALVGARLVPPGDVAALLAEHGLALVARALAVEDGTWAWEPGVGPPPSGFPLGPPFAA
FT                   LCAAVRALELPAVKRRLGDREERAASRMAGRVRIEDLRLTPQEARAAALVDGERSPAEI
FT                   AAASPADAAAVLRLSLLLGELDLLAFGAPRRARAPAPGVAPPPARAATPTPTPRPTPTP
FT                   VPPPAAAPAAAAPRPPPPRPPPVAAAPAPRTTPAPAAVRRATALEPAALRATLASLQDA
FT                   DHFQVLGVKRDAPAAQVKVAYFQLAKLYHPDAIPTDAPADVRKLCADLFGRVSAAWAEL
FT                   GDEARRAQYLQELQSGGAPEVDVMGILQAENLFQTGTQLVKARRYDEALAKFLEALQLN
FT                   PEEPEFGIWKAWCEFLRADDKKRQQAQSAAAVEAGLKKNPRCAPGYLFLGQMAKVLGDL
FT                   ALAERHLRRGLAAAPDNADLARELKYLRK"
     gtgagcgacg cacccccgaa gccccccggc gagacgcctc ccccgcggac ccggccggac        60
     gtcccggccg gcccgccgcg gctcgagcgc gtgccggacg gctaccgccc gcccgcggtg       120
     ccgcgcgcgg ccgccccggc ggcgcgtccg ccgcccccgc cgccgcccgc gccgacctac       180
     ggcctcgcgg cgcgcgaggt cggcgccgac gcggccatcg cggccgggct cgcgcaccag       240
     ggcgcgctcg ccgccgactc cgcgctgcgc ctctacggcc tcgcggccgc gacgcgggcg       300
     agcggccggc tcacgctggc gccggagggc cgctcctacg cgctcgtgtt ccgccgcggc       360
     gcggtggagc acgccgcgtc ctccgacccg gccgacgacc tgggccgctt cctgctccgc       420
     aagggcgtgc tgcggcccga gcagctcgtc gaggccgagg cggcgcgcgc cgccgccggc       480
     ggcgacctcg ccgcggcgct ggtcggggcg cggctcgtcc cgccgggcga cgtggccgcg       540
     ctgctcgccg agcacgggct ggcgctggtg gcgcgggcgc tcgcggtcga ggacggcacc       600
     tgggcctggg agccgggggt cgggccgccg ccgtccgggt tcccgctcgg cccgccgttc       660
     gcggcgctgt gcgcggcggt ccgcgcgctc gagctccccg cggtgaagcg gcggctcggc       720
     gatcgcgagg agcgcgccgc ctcgcggatg gcggggcggg tgcggatcga ggacctgcgc       780
     ctcacgccgc aggaggcgcg cgcggcggcg ctcgtcgatg gcgagcggag cccggccgag       840
     atcgcggcgg cgagccccgc cgacgcggcc gcggtgctgc ggctgtcgct gctgctcggc       900
     gagctcgacc tgctcgcctt cggcgcgccg cggagggctc gcgcgcccgc gcccggcgtg       960
     gccccgccgc ccgcgcgcgc ggcgacgccc acgcccacgc cacgtcccac gcccacgccg      1020
     gtgccacccc cggccgccgc gcccgccgcg gctgcgcccc ggcccccgcc gccgcgcccg      1080
     ccccccgtcg ccgccgcccc ggcgccgcgg accaccccgg ccccggccgc ggtgcgccgc      1140
     gccaccgcgc tcgagccggc cgcgctgcgc gccacgctcg cctcgctgca ggacgccgat      1200
     cacttccagg tgctgggggt gaagcgggac gcgcccgccg cgcaggtgaa ggtcgcctac      1260
     ttccagctcg cgaagctcta ccaccccgac gccatcccca ccgacgcgcc ggccgacgtg      1320
     cggaagctct gcgccgacct cttcgggcgg gtgagcgccg cctgggccga gctcggcgac      1380
     gaggcccgcc gcgcgcagta cctgcaggag ctgcagagcg gcggggcgcc cgaggtggac      1440
     gtgatgggca tcctgcaggc cgagaacctg ttccagaccg ggacccagct cgtgaaggcg      1500
     cgccgctacg acgaggcgct cgcgaagttc ctggaggcgc tccagctcaa cccggaggag      1560
     ccggagttcg gcatctggaa ggcctggtgc gagttcctcc gggccgacga caagaagcgc      1620
     cagcaggcgc agagcgccgc ggcggtcgag gcgggcctga agaagaaccc gcgttgcgcg      1680
     cccggctacc tgttcctcgg ccagatggcg aaggtgctcg gcgacctcgc gctcgccgag      1740
     cgccacctgc gccgcgggct cgccgccgcg ccggacaacg ccgacctcgc ccgcgagctg      1800
     aagtacctcc gcaagtag                                                    1818
//

If you have problems or comments...

PBIL Back to PBIL home page