(data stored in ACNUC7421 zone)

EMBL: CP000251.PE259

CP000251.PE259       Location/Qualifiers
FT   CDS_pept        307554..308117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0261"
FT                   /product="protein of unknown function UPF0044"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80037"
FT                   /db_xref="GOA:Q2IMK4"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMK4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80037.1"
FT                   /translation="MPAPTNPKKRALMPSSPLRRALRAAGHHLSPVVQVGKDGLTEAVL
FT                   RQLDEALLAHELVKMKVGTESPEDRLEIADRLLAEDVQVAQVLGRTVLAYRRHPERPRF
FT                   EPAPAGAAAERAERPEPRRAPGKGRRAPTRGPRAAAREQRAPAKGKRPLAKGKRAPANG
FT                   RRPPANGKRPATRRPAPRAKRTKR"
     atgcccgcac ccacgaaccc gaagaagcgc gccctcatgc cgtcctcccc gctgcggcgc        60
     gcgctgcgcg ccgccggcca ccacctctcg ccggtggtcc aggttggcaa ggacgggctc       120
     accgaggcgg tcctccgcca gctcgacgag gcgctcctcg cgcacgagct ggtcaagatg       180
     aaggtcggga cggagagccc cgaggaccgc ctcgagatcg ccgaccggct cctcgccgag       240
     gacgtccagg tcgcgcaggt gctgggccgg accgtgctcg cgtaccggcg gcacccggag       300
     cggccccgct tcgagccggc gcccgcgggc gccgcggcgg agcgggcgga gcggccggag       360
     ccgaggcgcg cgcccgggaa gggaaggcgc gcgccgacga gggggccgcg cgcggccgcg       420
     agggagcagc gcgcgcctgc caaggggaag cgcccgctcg cgaaggggaa gcgcgcgccc       480
     gcgaacggga ggcgcccgcc cgcgaacggg aagcgccccg cgacgcgccg gccggcgccg       540
     cgcgcgaagc gcacgaagcg ctag                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page