(data stored in ACNUC7421 zone)

EMBL: CP000251.PE26

CP000251.PE26        Location/Qualifiers
FT   CDS_pept        29510..30589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79804"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILX0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79804.1"
FT                   /translation="MERTGRGFVGAVLLACLAVATSARGAESYTVVAGGLESPRGLAFG
FT                   PGGRLYVAQAGSGGTTGKISEIRGAGTASPAIRDVVTGLVSAGDEGEFVGVDGLSALGN
FT                   GTLYAIMALSNEATGFASALGHLLQVNPAGRVRSVADVGDFDFDWTAEHVELAPDDFPD
FT                   ANPYAVLAAGGRVYVADAGANTLDLVRPDGSIQVLAYFPNPLAPDGTPVKDATPTCIAE
FT                   GPDGALYVGTLALAASLRFGPSAAVYRVDPGAALPGDLEVTLNLATPWATGLPPINGCA
FT                   FGPDGSFYASLLATGPDLANPHSDVVKIPFDDPTARELLTGGELMFPAGVAVGPDGAVY
FT                   VSNHAAFVPDGQVVRLARR"
     atggaaagaa cgggtcgggg gttcgtcggc gcggtgctcc tcgcttgcct cgcggtcgcg        60
     acgtcggcgc gcggcgcgga gtcgtacacg gtggtggccg gagggctcga gagcccgcgc       120
     ggcctggcgt tcgggccggg cgggcggctc tacgtggcgc aggccggctc gggcggtacg       180
     acgggcaaga tcagcgagat ccgcggggcg ggcacggcct cgcccgcgat ccgcgacgtg       240
     gtgacgggcc tcgtctccgc gggggacgag ggggagttcg tgggggtgga cgggctgtcg       300
     gcgctcggca acggcacgct ctacgcgatc atggcgctct cgaacgaggc caccggcttc       360
     gcctccgcgc tcgggcatct cctgcaggtg aaccccgcag gcagggtccg cagcgtcgcg       420
     gacgtcggcg acttcgactt cgactggacg gccgagcacg tggagctcgc cccggacgac       480
     ttcccggacg cgaaccccta cgccgtgctg gccgccggtg ggcgcgtcta cgtcgccgac       540
     gcgggcgcga acacgctcga cctggtccgc ccggacggct cgatccaggt cctcgcgtac       600
     ttcccgaacc cgctcgcgcc ggacgggacg ccggtgaagg acgcgacgcc gacgtgcatc       660
     gccgagggac ccgacggcgc gctctacgtc gggacgctcg cgctggcggc gagccttcgg       720
     ttcgggccgt cggccgcggt gtaccgggtc gatccgggcg cggcgctccc gggcgacctc       780
     gaggtgaccc tgaacctcgc gacgccatgg gccacgggtc tcccgccgat caacggctgc       840
     gccttcggcc cggacggcag cttctacgcc tcgctcctcg ccaccggccc ggacctcgcg       900
     aacccgcaca gcgacgtcgt gaagatcccg ttcgacgacc cgaccgcgcg cgagctgctc       960
     accggcgggg agctgatgtt ccccgccggc gtggcggtcg ggccggacgg cgcggtgtac      1020
     gtgtccaacc acgccgcgtt cgtcccggac ggccaggtgg tgcggctggc gcggcggtga      1080
//

If you have problems or comments...

PBIL Back to PBIL home page