(data stored in ACNUC7421 zone)

EMBL: CP000251.PE261

CP000251.PE261       Location/Qualifiers
FT   CDS_pept        308583..309182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80039"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMK7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80039.1"
FT                   /translation="MTRAVKRLIRDVALRMPELGHVRASRVLVVAGEARRSSRATIRPA
FT                   HFGATRRRAGEGGAVKPLVRIKGRKILYVVTLRPLWFLASTPEERIGTILHELYHASNR
FT                   FDGTLHRGRRHSRFPRARYNRKIRTLLRAYLAQAPEDVVAPFAHQGVVRARMWLERPGS
FT                   FRAGEYSGRRLYTEKQLFYGLVRMRAGARRRGQPAG"
     atgacacgtg ccgtgaagcg gctgatccgc gacgtcgcgc tccggatgcc cgagctcggc        60
     cacgtgcgcg cgtcgcgcgt gctggtggtg gccggcgagg cccggcgcag ctcgcgggcc       120
     accatccggc cggcgcactt cggcgcgacg cgccgccggg ccggggaggg cggggcggtg       180
     aagcccctgg tgcgcatcaa ggggcggaag atcctgtatg tggtgacgct gcggccgctg       240
     tggttcctgg cctccacgcc cgaggagcgg atcggcacca tcctccacga gctgtaccac       300
     gcgtcgaacc gcttcgacgg caccctgcac cgcggccgcc ggcactcgcg cttcccgcgc       360
     gcccgctaca accgcaagat ccgcaccctg ctccgcgcct acctggcgca ggcgccggag       420
     gacgtggtcg cgccgtttgc ccaccaagga gtggtgcgcg cgcggatgtg gctggagcgg       480
     cccgggtcgt tccgcgccgg cgagtactcg gggcggcggc tctacaccga gaagcagctc       540
     ttctacggcc tggtccggat gcgcgccggc gcgcgccgcc gcggccagcc ggcgggctag       600
//

If you have problems or comments...

PBIL Back to PBIL home page