(data stored in ACNUC7421 zone)

EMBL: CP000251.PE268

CP000251.PE268       Location/Qualifiers
FT   CDS_pept        313952..317332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80046"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IML3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80046.1"
FT                   /translation="MRKKLLRLLRIAPLALLFAGVAFAQTTGTIIGVVTDASTGKPVAG
FT                   AVIVARSPNLQGEQTAVTDANGNYRITLLPPGAYSLAVQLEGFKPAERSDITMRADKTI
FT                   RANIAVVPEAVQMEEQVVRTGAAPVVNIGAAESGAVVSREFMANIPVGRSVENVATVVP
FT                   TAQADTYGVSFAGAQSPENSYIVDGLNVTDPVYGTFAGNPNSQTLTPTLQNNFVQEIDV
FT                   KTGGFQPEYGRTTGGVLNVVTRSGSNEYHGSVFTDFTPRMLIDPTGKIAGTNGEAIGWR
FT                   RKPNEGAYDLDFGFEVGGPIMKDKLWFYAGVAPIVTRTYTERFLQLNRLAADPDTGEMV
FT                   PVVNESSGLIEQDIVPGTEKVYRSGRTTYQYVGKLTYLLDENNNLTLSAVGMPTSATSI
FT                   SMAGGPSRRTFDESGNTFDGSLRYAGKFLEKRLIVEAQAGWHYNSSAPKDKTQAGVDQL
FT                   NTPTLQFRFRTPVTNFEQLDECANDGNQNARCGVNLYNIGGLGYLSDAVSNRLATRVSA
FT                   SYLSEFLGSHNTKVGVDFERSTFAQDKRYAGGYYYATTGNGIIYTRRGYGYVNTPDVPP
FT                   DDPNYGLIPTSRGTITGTSTVPGNVVFATRVQNTAGTNSTAVFAQDSWQLPQNVTLNYG
FT                   IRWEGQSLNNISNPSSNGFTINNSWAPRVQAIWDFTGSGRGKVAGSWGRFFYAMPLDLG
FT                   DRTFGAERSLLYYMPTSTVGGAPGCAIPGNATRGGMSSPTDQSLVSYDTRQLSPSACGV
FT                   TNWGGNYAQGGADLRNRNFLFGTSGTAASPVSPDISQAYVDQFGGQIEYEVLSDLSVGL
FT                   EYAGRRQGDIIEDMSPNDGLGYYIGNPTKGGEFTGSDGVVYNPSAPTATDTATGRVMVI
FT                   PFPKPERSYDGVTLSVRKNFSRGWQASASYTYSVLRGNYAGPYRPEDDQLDPGITSQYD
FT                   IPSIMTNQKGYLYGDRPHQIKLFGSYTWAASPRFSLTGGAAYTGQSGNPVSALAGYNDS
FT                   YDVSQTFVVPRGMGGRSPWTNKVDLRGAVEYVIKAPYALKFTVDVFNVFNSEDAVIMDQ
FT                   DYTFDMTQPISGAKCSNKSSVGKANPVQALQSACPDLKYLKTIDGRNVTVNPNWGRPAP
FT                   GTASFMMPLSLRLGLSLSF"
     atgaggaaga agttgctgcg cctcctgcgg atcgcgccgc tcgcgctgtt gttcgcggga        60
     gtcgcgttcg cccaaacgac cggcacgatc atcggtgtgg tgaccgatgc gtcgaccggt       120
     aagcccgtcg caggtgccgt catcgtcgcg cggagcccga atctccaggg tgagcagacg       180
     gcggtcaccg acgcgaacgg caactaccgg atcacccttc tcccccctgg cgcgtactcc       240
     ctggcggtcc agctcgaggg cttcaagccc gccgagcggt cggacatcac gatgcgcgcg       300
     gacaagacca tccgcgccaa catcgcggtg gtccccgagg ccgtgcagat ggaggagcag       360
     gtcgtccgga cgggcgccgc acccgtggtg aacatcggcg ccgccgagag cggcgcggtg       420
     gtctcccgcg agttcatggc gaacatcccg gtcgggcgct cggtcgagaa cgtggcgacc       480
     gtcgtcccga cggcgcaggc cgacacctac ggtgtcagct tcgccggcgc ccagtcgccc       540
     gagaactcgt acatcgtgga cggcctgaac gtgaccgacc cggtgtacgg cacgttcgcc       600
     ggcaacccga actcccagac gctcacgccg accctgcaga acaacttcgt gcaggagatc       660
     gacgtcaaga ccggcggctt ccagccggag tacggccgca ccaccggcgg cgtgctgaac       720
     gtcgtcaccc gcagcggctc gaacgagtac cacgggtcgg tgttcaccga cttcaccccg       780
     cgcatgctga tcgacccgac cggcaagatc gccggcacga acggcgaggc gatcggctgg       840
     cgccgcaagc cgaacgaggg cgcgtacgac ctcgacttcg gcttcgaggt cggcggtccg       900
     atcatgaagg acaagctgtg gttctacgcc ggcgtcgcgc cgatcgtgac ccgcacctac       960
     accgagcgct tcctccagct gaaccggctg gcggcggacc cggacaccgg tgagatggtc      1020
     ccggtcgtca acgagtcctc cggcctcatc gagcaggaca tcgtcccggg cactgagaag      1080
     gtctaccgct ccggccgcac cacctaccag tacgtcggca agctgaccta cctgctcgac      1140
     gagaacaaca acctgacgct gtccgcggtc ggcatgccga ccagcgcgac cagcatctcg      1200
     atggccggcg gccccagccg ccgcacgttc gacgagagcg gcaacacgtt cgacggcagc      1260
     ctgcgctacg ccggcaagtt cctcgagaag cggctcatcg tcgaggcgca ggcgggctgg      1320
     cactacaaca gcagcgcccc gaaggacaag acgcaggccg gcgtcgatca gctcaacacg      1380
     ccgaccctgc agttccgctt ccggacgccg gtcaccaact tcgagcagct cgacgagtgc      1440
     gcgaacgacg gcaaccagaa cgcccgctgc ggcgtcaacc tctacaacat cggcggcctc      1500
     ggctacctga gcgacgcggt gtcgaaccgc ctcgccaccc gcgtgtcggc gtcgtacctg      1560
     tccgagttcc tcggctcgca caacaccaag gtcggcgtgg acttcgagcg ctccacgttc      1620
     gcgcaggaca agcgctacgc gggcggctac tactacgcca ccaccggcaa cggcatcatc      1680
     tacacgcgcc gcggctacgg ctacgtcaac acgccggacg tgcccccgga cgatccgaac      1740
     tacggcctga ttccgacctc ccgcggcacg atcaccggca cgagcaccgt tccgggcaac      1800
     gtggtgttcg ccacccgcgt gcagaacacg gccggcacga acagcacggc cgtcttcgcg      1860
     caggacagct ggcagctgcc gcagaacgtg accctgaact acggcatccg gtgggagggg      1920
     cagtcgctga acaacatcag caacccctcg tccaacgggt tcacgatcaa caacagctgg      1980
     gcgccccgcg tgcaggccat ctgggacttc accggcagcg gccgcggcaa ggtggccggt      2040
     agctggggcc gcttcttcta cgcgatgccg ctcgacctcg gcgaccgtac cttcggtgcg      2100
     gagcgctcgc tgctctacta catgccgacg agcaccgtgg gcggcgcgcc tggctgcgcc      2160
     atccccggga acgcgacccg cggcggcatg tccagcccga ccgatcagtc gctcgtgagc      2220
     tacgacaccc ggcagctcag cccgtccgcc tgcggcgtga cgaactgggg cggcaactac      2280
     gcgcagggcg gcgccgacct ccggaaccgc aacttcctgt tcggcacctc cggcaccgct      2340
     gcgtcgccgg tgtcgccgga catctcccag gcgtacgtgg atcagttcgg cggccagatc      2400
     gagtacgagg tgctgtccga cctgtccgtc ggcctcgagt acgccggccg ccgccagggc      2460
     gacatcatcg aggacatgtc cccgaacgac ggcctcgggt actacatcgg caacccgacc      2520
     aagggcggcg agttcacggg ctccgacggc gtcgtgtaca acccgtctgc gccgacggcg      2580
     accgacacgg ccaccggccg cgtcatggtc atcccgttcc cgaagccgga gcgcagctac      2640
     gacggcgtca cgctctccgt ccgcaagaac ttctctcgcg gctggcaggc gtcggcgtcc      2700
     tacacgtact cggtgctccg cggcaactac gcggggccgt accgccccga ggacgaccag      2760
     ctcgacccgg gcatcacctc ccagtacgac atcccgtcga tcatgacgaa ccagaagggc      2820
     tacctgtacg gagaccgtcc gcaccagatc aagctcttcg ggtcgtacac ctgggccgcg      2880
     tcgccgcgct tcagcctcac cggcggcgcc gcgtacaccg gccagtccgg caacccggtc      2940
     agcgcgctgg ccggctacaa cgactcgtac gacgtctccc agacgttcgt cgtgccgcgc      3000
     ggcatgggcg gccggtcgcc ctggaccaac aaggtggacc ttcgcggcgc agtcgagtac      3060
     gtcatcaagg cgccgtacgc gctgaagttc acggtggacg tcttcaacgt gttcaacagc      3120
     gaggacgccg tgatcatgga ccaggactac acgttcgaca tgacgcagcc gatcagcggc      3180
     gcgaagtgct cgaacaagtc ctcggtcggc aaggccaacc cggtgcaggc gctccagtcg      3240
     gcctgccccg atctcaagta cctcaagacg atcgacggcc gtaacgtgac cgtcaatccg      3300
     aactggggtc ggccggctcc cggcacggcg tcgttcatga tgccgctgtc gctgcgcctc      3360
     ggcctgtcgc tcagcttcta g                                                3381
//

If you have problems or comments...

PBIL Back to PBIL home page