(data stored in ACNUC7421 zone)

EMBL: CP000251.PE269

CP000251.PE269       Location/Qualifiers
FT   CDS_pept        317355..318146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80047"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IML2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80047.1"
FT                   /translation="MKTLTKLALTLIAVAGLQACDPYEDENKGVPSVINVISSDSGTAY
FT                   EGTNTGTSWTISTPSAFVLFVKVNAGKLLDGASIQATTDDCTPANDWLSVNGAGPGNWM
FT                   SCYYPQSPAGFEGASVVLYPGPSISTVDSWFSLSELEPGIFNLAGTVSDKQGHPLAIDV
FT                   NAFVNDLAAAQSDTAGTEITTEFSDAGVNMTNVQLWEAPDVSGAPGTWTAVATTTPYVH
FT                   AGVAVGSTWWYKVTADTNGFPATAASFETAPVSVTTEPPAP"
     atgaagacgc tgaccaagct cgcgttgacg ctgatcgcgg tcgccggcct gcaggcctgc        60
     gatccgtacg aggacgagaa caagggcgtg ccatcggtca tcaacgtcat ctcatccgac       120
     agcggcaccg cgtacgaggg cacgaacacg gggacgagct ggaccatctc gaccccgtcc       180
     gcgttcgtgc tgttcgtgaa ggtgaacgcg ggcaagctgc tcgacggcgc ctcgatccag       240
     gcgaccaccg acgactgcac gccggccaac gactggctgt ccgtcaacgg cgccggcccc       300
     ggtaactgga tgtcctgcta ctacccgcag tctccggcgg ggttcgaggg cgcctcggtc       360
     gtgctgtacc ccggcccctc gatctccacc gtggactcgt ggttcagcct gtccgagctc       420
     gaacccggca tcttcaacct cgccgggacg gtctcggaca agcaggggca cccgctcgcc       480
     atcgacgtga acgcgttcgt gaacgatctc gcggcggcgc agtcggacac cgccgggacg       540
     gagatcacga ccgagttcag cgatgcgggc gtcaacatga ccaacgtgca gctctgggag       600
     gcgccggacg tcagcggcgc gcccgggacc tggacggcgg tcgcgacgac gacgccgtac       660
     gtccacgccg gcgtcgcggt gggctccacc tggtggtaca aggtgaccgc cgacacgaac       720
     ggcttcccgg ccaccgccgc cagcttcgag acggccccgg tgagcgtcac gacggagccg       780
     ccagcgccgt aa                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page