(data stored in ACNUC7421 zone)

EMBL: CP000251.PE271

CP000251.PE271       Location/Qualifiers
FT   CDS_pept        complement(319122..320027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0273"
FT                   /product="SSU ribosomal protein S2P"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80049"
FT                   /db_xref="GOA:Q2IML9"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IML9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80049.1"
FT                   /translation="MKALLEAGVHFGHQTKRWNPKMKPFIFGARNGIYIIDLQKTVGLA
FT                   RNALRFVSDSVAKGGSVLFVGTKKQAQDAIREEASRSGQFFVTNRWLGGTLTNFKTVKQ
FT                   GIDRLKTIEKMAADGTYERLPKKEVAQLEREREKLEKNLGGIKELSRLPSALFVIDTKK
FT                   EHIAVHEANRLGIPVVAVVDTNCDPEGIDYVIPGNDDAIRSIRLFTGKVAEACIEGKGR
FT                   YSAWVAEHGGHDERREQEDRDAASERGHKDRRDRRDRRGGPRERREPREDRAAASANVE
FT                   VVRKGEVAPAAAPEAAPAKE"
     atgaaggcgc tgctggaggc cggcgtccac ttcggccacc agaccaagcg ctggaacccg        60
     aagatgaagc cgttcatctt cggcgcgcgc aacggcatct acatcatcga cctgcagaag       120
     acggtcggcc tggcccgcaa cgcgctccgc ttcgtgtccg actcggtcgc gaagggcggc       180
     tcggtgctgt tcgtgggcac gaagaagcag gcgcaggacg ccatccgcga ggaggcctcc       240
     cgctccggcc agttcttcgt cacgaaccgc tggctgggcg gcacgctgac caacttcaag       300
     acggtgaagc agggcatcga ccggctgaag accatcgaga agatggcggc cgacggcacc       360
     tacgagcgcc tcccgaagaa ggaggtcgcc cagctcgagc gcgagcgcga gaagctggag       420
     aagaacctgg gcggcatcaa ggagctgtcc cgcctgccgt ccgcgctctt cgtgatcgac       480
     acgaagaagg agcacatcgc ggtgcacgag gcgaaccgcc tcggcatccc ggtggtcgcg       540
     gtggtggaca cgaactgcga tcccgagggc atcgactacg tgatccccgg caacgacgac       600
     gcgatccgct cgatccgcct gttcaccggg aaggtcgcgg aggcctgcat cgagggcaag       660
     ggccgctact cggcctgggt cgccgagcac ggcggccacg acgagcgccg cgagcaggag       720
     gaccgcgacg cggccagcga gcgcggccac aaggatcgcc gcgatcgccg cgaccgccgc       780
     ggcgggccgc gtgagcgccg cgagccgcgc gaggaccgcg ccgccgccag cgcgaacgtc       840
     gaggtggtgc gcaagggcga ggtcgccccg gccgccgcgc ccgaggccgc tccggcgaag       900
     gagtag                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page