(data stored in ACNUC7421 zone)

EMBL: CP000251.PE277

CP000251.PE277       Location/Qualifiers
FT   CDS_pept        325334..326983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80055"
FT                   /db_xref="GOA:Q2IMM3"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMM3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80055.1"
FT                   /translation="MHEPSTKNDLFRPAYPAEDLEENRDRRPPPGLALDPPEAPPPEHP
FT                   PEIPVDRLDGDALKVIARLRHMHHQAYLVGGCVRDLLLGATPKDFDVATDAHPGEVRAI
FT                   FRNCRLIGRRFRLAHVYFRAGKVIEVATFRKNPTDVAEDVGEGEGDLLITRDNVFGTAE
FT                   EDSVRRDFTVNGLFYDVATGEVIDYVGGRADLEAHRISTIGDPEIRMREDPVRALRAVR
FT                   FAARLGFTIAPDTFEAMRRTAGELARCAPARVLEETFKLLRCGGSARAFELLRACGALP
FT                   VILPALGAALETWDDGRRRAFFAHLAALDRLVRSGAEVSEAVLLGALLMHLGADAPRAG
FT                   RPDADAGAPRWDEADAFLASLVQTARLPRKVAERIRLALQAQRQLEEPGKRRRRRGRGP
FT                   AGQTYFQDALQLLEIRVRATGSGGEALERWTAEAPHAHPAAERPGRAGPREDRRDHRRE
FT                   GAAPRRPDRDEGAVREVVIPVEAAEAADEAGEEVREVESSAAGDAGEGEASQGGRRRRR
FT                   RRGGKRRRRRGAGASGPDGGAQVPPAEAGGQG"
     atgcacgagc catccacgaa gaacgacctt ttccgtccgg cgtaccccgc agaagacctc        60
     gaagagaacc gagaccgccg cccgccgccg ggcctggcgc tcgatccccc cgaagccccg       120
     ccgccggagc acccgcccga gatccccgtc gatcgcctcg acggcgacgc gctgaaggtg       180
     atcgcgcggc tgcggcacat gcaccaccag gcctacctgg tgggcggctg cgtccgcgac       240
     ctgctgctcg gcgcgacccc caaggacttc gacgtcgcga ccgacgccca ccccggcgag       300
     gtccgcgcga tcttccgcaa ctgccgcctc atcggccgcc gcttccgcct ggcgcacgtg       360
     tacttccgcg ccggcaaggt gatcgaggtc gccaccttcc ggaagaaccc gaccgacgtc       420
     gccgaggacg tgggcgaggg cgagggcgac ctgctcatca cccgggacaa cgtcttcggc       480
     acggccgagg aggactcggt ccgccgcgac ttcaccgtga acggcctgtt ctacgacgtc       540
     gccaccggcg aggtgatcga ctacgtgggc gggcgcgccg acctcgaggc gcaccggatc       600
     tcgaccatcg gcgatcccga gatccgcatg cgcgaggacc cggtgcgggc gctgcgcgcg       660
     gtccggttcg cggcgcgcct cgggttcacc atcgcgccgg acacgttcga ggcgatgcgg       720
     cggacggccg gcgagctggc gcgctgcgcg ccggcgcggg tgctggagga gacgttcaag       780
     ctgctccgct gcggcgggtc ggcccgcgcg ttcgagctgt tgcgcgcctg cggcgcgctg       840
     ccggtgatcc tgcccgcgct cggcgcggcg ctcgagacct gggacgacgg gcggcgccgc       900
     gcgttcttcg cgcacctcgc cgcgctcgac cggctggtcc gctccggcgc ggaggtctcc       960
     gaggcggtgc tgctcggcgc gctgctcatg cacctcggcg ccgacgcgcc ccgcgccggc      1020
     cgcccggacg cggacgccgg cgcgccgcgc tgggacgagg ccgacgcgtt cctcgcctcg      1080
     ctcgtccaga cggcccggct gccgcgcaag gtggccgagc gcatccggct cgcgctgcag      1140
     gcgcagcggc agctcgagga gccgggcaag cgccggcggc gccgcgggcg cggcccggcc      1200
     ggccagacct acttccagga cgcgctgcag ctcctcgaga tccgcgtgcg cgccaccggc      1260
     agcggcggcg aggcgctgga gcgctggacg gccgaggcgc cgcacgccca tccggcggcg      1320
     gagcgcccgg gccgcgccgg cccgcgcgag gaccgccgcg accaccgccg cgagggcgcg      1380
     gcgccgcgcc ggcccgaccg cgacgagggc gcggtgcgcg aggtggtgat cccggtcgag      1440
     gccgccgagg ccgccgacga ggcgggcgag gaggtccgcg aggtcgagtc ctcggccgcc      1500
     ggcgacgccg gggagggcga ggcgtcgcag ggcgggcgcc gcaggcgccg ccgccggggc      1560
     gggaagcgcc gccgccgccg cggggccggg gcgtccgggc cggacggggg cgcgcaggtg      1620
     ccgcccgccg aggccggcgg gcaagggtga                                       1650
//

If you have problems or comments...

PBIL Back to PBIL home page