(data stored in ACNUC7421 zone)

EMBL: CP000251.PE278

CP000251.PE278       Location/Qualifiers
FT   CDS_pept        327055..327810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0280"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.22"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80056"
FT                   /db_xref="GOA:Q2IMM2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IMM2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80056.1"
FT                   /translation="MASEKASNPKARYQRILLKLSGEALMGDGKYGISPKTLTSIAHDV
FT                   KDVVDLGVEVALTIGGGNIFRGVSGATEGMDRSSADYMGMLATVINSMALQDALEKIGV
FT                   PTRVQSAIEMHQVAEPYIRRRAIRHLEKGRVVIFAAGTGNPYFTTDTAASLRAMEIHAD
FT                   VLLKATKVDGVYTDDPKKNPAATKFKQLSYIDVLKKNLKVMDSTAISLCMDNDLPIVVF
FT                   DLTQRGNVRKVVLGEEIGTTVGRPSARNA"
     atggcgagcg agaaagcctc caacccgaag gcccgttacc agcgcatcct gctcaagctc        60
     tcgggcgagg cgctcatggg cgacggcaag tacggcatct cgccgaagac cctcacctcg       120
     atcgcccacg acgtgaagga cgtggtggac ctcggcgtcg aggtcgcgct caccatcggc       180
     ggcggcaaca tcttccgcgg cgtgtcgggc gcgaccgagg ggatggaccg ctcctcggcc       240
     gactacatgg gcatgctcgc cacggtgatc aactcgatgg cgctgcagga cgcgctcgag       300
     aagatcggcg tgccgacccg cgtgcagtcc gccatcgaga tgcaccaggt ggccgagccg       360
     tacatccgcc gccgcgccat ccgccacctg gagaaggggc gggtggtgat cttcgccgcc       420
     ggcaccggca acccctactt caccaccgac accgccgcct cgctccgcgc catggagatc       480
     cacgcggacg tgctgctcaa ggcgaccaag gtggacggcg tctacaccga cgatccgaag       540
     aagaacccgg cggcgaccaa gttcaagcag ctcagctaca tcgacgtcct gaagaagaac       600
     ctgaaggtga tggactccac cgccatcagc ctctgcatgg acaacgacct ccccatcgtc       660
     gtgttcgacc tcacccagcg cgggaacgtg cgcaaggtcg tgctcggcga ggagatcggg       720
     accaccgtgg ggcgccccag cgcccgcaac gcgtag                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page