(data stored in ACNUC7421 zone)

EMBL: CP000251.PE285

CP000251.PE285       Location/Qualifiers
FT   CDS_pept        332516..333610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0287"
FT                   /product="ABC-type Fe3+ transporter, periplasmic ligand
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMN2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80063.1"
FT                   /translation="MRRSLAAALAAALAAALAAALAAALAALASAGGLAGCRRAGPELP
FT                   EVRLHASPDLPGEVVRDLAARFAVARVVLVPRAEDAEVAWASDPAALLALAPRLVPGSA
FT                   APDPATARFADPQGRFAPVAARARVLLVARDGRLPVDPVNLRDLADPRLRGRIALAHPS
FT                   RGAGPATCAALSLVYGEASVGRFLRLVAANAPVVVGSDAEVRAAVAAGRAAVGLAGSVD
FT                   GAAGAASAAALRVVYPDQAGRGAVVLPTAAAALAPAGGGAPSPAAARLVAWMAGRDAER
FT                   ILVARAPGLLPLRPETPVPVGVEPAGNLRALSLDWDRLAAEAARLAPLLERWPDGFAAA
FT                   GHGRAGATEAASPEGRPGRADHAP"
     atgcgccgct cgctcgccgc cgccctcgcc gccgccctcg ccgccgccct cgccgccgcc        60
     ctcgccgccg ccctcgcggc gctagcctcc gccggcgggc tggcggggtg ccgccgcgcc       120
     ggccccgagc tgcccgaggt ccgcctgcac gcctcgcccg acctgccggg cgaggtggtg       180
     cgcgacctcg ccgcccgctt cgcggtggcg cgggtggtgc tcgtgccccg cgccgaggac       240
     gcggaggtgg cctgggcctc ggatcccgcg gccctcctcg cgctggcgcc gaggctcgtg       300
     ccgggcagcg ccgcgcccga tccggccacc gcgcggttcg ccgatccgca ggggcgcttc       360
     gcgccggtgg cggcgcgcgc gcgggtgctg ctcgtggccc gggacgggcg cctgccggtg       420
     gatcccgtca acctgcgcga cctcgccgat ccgcgcctgc ggggccgcat cgcgctcgcg       480
     cacccatcgc gcggcgccgg gccggcgacc tgcgcggccc tctcgctcgt ctacggcgag       540
     gcgagcgtgg gacgcttcct gcgcctcgtc gcggcgaacg cgccggtggt cgtgggctcg       600
     gacgcggagg tgcgcgcggc ggtggcggcg gggcgcgccg cggtgggcct ggccggctcg       660
     gtggacggcg ccgccggcgc ggcgagcgcg gccgccctgc gcgtggtcta cccggaccag       720
     gccgggcgcg gggcggtggt gctgccgacc gcggcggcgg cgctcgcgcc ggcgggcggg       780
     ggcgcgccct cgcccgcggc ggcacggctg gtggcctgga tggcggggcg ggacgcggag       840
     cggatcctgg tggcgcgcgc gccggggctc ctgccgctgc gccccgagac cccggtgccg       900
     gtcggcgtcg agccggccgg caacctgcgc gcgctctcgc tcgactggga ccggctcgcc       960
     gcggaggcgg cccggctcgc gccgctgctc gagcgctggc cggacgggtt cgccgcggcg      1020
     gggcacgggc gcgcgggcgc gacggaagcg gcgtcccccg agggacggcc ggggcgcgcc      1080
     gatcacgcac cgtga                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page