(data stored in ACNUC7421 zone)

EMBL: CP000251.PE288

CP000251.PE288       Location/Qualifiers
FT   CDS_pept        complement(336521..337117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80066"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMN7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80066.1"
FT                   /translation="MPSRLRRFLHLERPRDGGAAPDPATGAADRAARFGAVQPPGPAAA
FT                   GPSATGARLERFGAEPEPALQLLDRGDRLPFTRCLRCGMDSHALAVECPGCGAALDTPE
FT                   QRAADERLRVERARQAGEEARAAAARREAFAREEAEEAGARRALGEALAQEVGERERRR
FT                   LEAEGLGGGPGPLELGARVLRALGARWGRGGGGRG"
     gtgccctccc gcctccgccg cttcctgcac ctcgagcgcc cgcgcgacgg cggcgccgcg        60
     cccgacccgg cgaccggcgc cgcggaccgc gccgcgcgct tcggcgcggt ccagcccccg       120
     gggcccgcgg cggccgggcc ctccgccacc ggcgcgcggc tggagcgctt cggcgcggag       180
     ccggagcccg cgctccagct cctcgaccgc ggcgaccgcc tcccgttcac gcggtgcctc       240
     cgctgcggca tggacagcca cgcgctcgcg gtggagtgcc cgggctgcgg cgccgcgctc       300
     gacaccccgg agcagcgggc cgccgacgag cggctccggg tcgagcgcgc gcgacaggcc       360
     ggcgaggagg cgcgcgcggc cgccgcgcgc cgggaggcgt tcgcccggga ggaggccgag       420
     gaggcaggag cccgccgcgc gctcggcgag gcgctggcgc aggaggtggg cgagcgcgag       480
     cggcggcggc tcgaggcgga ggggctgggc ggcgggccgg gcccgctcga gctgggcgcc       540
     cgcgtcctcc gcgccctcgg ggcgcgctgg ggccggggcg gtggcgggcg gggctga          597
//

If you have problems or comments...

PBIL Back to PBIL home page