(data stored in ACNUC7421 zone)

EMBL: CP000251.PE296

CP000251.PE296       Location/Qualifiers
FT   CDS_pept        complement(347873..350584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0298"
FT                   /product="peptidase M16-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80074"
FT                   /db_xref="GOA:Q2IMN8"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMN8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80074.1"
FT                   /translation="MLAPLATLAALALAAGPAAPPLELTTFSLPNGLTVVLAPDHRLPQ
FT                   VAVDTWFQVGSKDEAPGRTGFAHLFEHLMFMGTNRVPGNRFDVIMESGGGSNNASTSSD
FT                   RTNYFSVGPSQLLPTLLWLDADRLQALADAMTQEKLDLQRGVVRNERRQSYENTPYGAA
FT                   ELVIPEVMYPQGHPYHHPVIGSHADLEAATLEDVKGFFRTWYVPANATLVVAGDFRPDE
FT                   VRPLVERMFGAVPLRAPPAPARAAPVRLEREVRRILSDRVELPKLILVWHAPAAYADGS
FT                   AELELLADVLAEGPSSRLDRRLVQELRLAESVTAYLDPGRLGSLFRVEVTATPGADLER
FT                   VKREALAVVAELQAKGPEARELARVRAQAERRRREEREHLVHRADKLNEYLAYYGEPDG
FT                   FARDLARVTSATAGGLREAARGLGEGRLDLRVLPARAGAGAAKAEIPDAPPPPLATRPF
FT                   DPPAPEVFRLANGLEVRVAPRPGTGLFAAHLLLPGGAAAVPAEKAGLAPILAELLTSGA
FT                   GGRSAAEYADAIRALGASVEAEARPASLQVSVSGLSAHLAPALDLFADAVLRPNLARAD
FT                   FEREAALALARVEARPDDPRKVAPVVAAAAIFGRGDPRGRPVDGWAATVRTVTLDDVRR
FT                   LAPRLLDPRGATLVVAGDVDPAALRRLLAPRLGAWRGAGPAPAASPAALTAAQGGRILL
FT                   VDRPGAPQTRILLARPVAPAPEPARALRELVNVVLGGSFTSRLNQNLREKHGYTYGARS
FT                   AFATEGGQGLFTAGAAVQTEVTGAALVELRRELDGLAAAGVDAAETAKARETARHRTVE
FT                   EIQTTAGLAEALAAAVLEGRPPDALRREAEALTAVEPARAAAEAKAGPYAFGGFTVVLV
FT                   GDRKTVVPQLEKAGFPRPAAVDPDGTPIPDPE"
     atgctcgcgc cgctcgccac gctcgccgcc ctcgccctcg ccgccggccc ggccgcgccg        60
     ccgctcgagc tcaccacgtt ctcgctgccg aacgggctga cggtggtgct cgcgcccgac       120
     caccggttgc cgcaggtggc ggtggacacc tggttccagg tgggctcgaa ggacgaggcg       180
     cccgggcgca ccgggttcgc gcacctgttc gagcacctca tgttcatggg gacgaaccgc       240
     gtccccggga accgcttcga cgtgatcatg gagtcggggg gaggctccaa caacgcctcc       300
     acctcgtcgg accgcaccaa ctacttcagc gtggggccgt cgcagctcct ccccacgctg       360
     ctctggctgg acgcggaccg gctccaggcg ctcgccgacg ccatgacgca ggagaagctc       420
     gacctgcagc gcggggtggt gcgcaacgag cggcggcaga gctacgagaa cacgccgtac       480
     ggcgcggccg agctggtgat cccggaggtc atgtacccgc agggccaccc gtaccaccac       540
     ccggtgatcg gcagccacgc cgacctcgag gcggccacgc tcgaggacgt gaagggcttc       600
     ttccggacct ggtacgtgcc ggcgaacgcg acgctggtgg tggcgggcga cttcaggccc       660
     gacgaggtgc ggccgctcgt cgagaggatg ttcggcgcgg tgccgctgcg cgcgccgccc       720
     gcgcccgcgc gcgccgcgcc ggtgcggctc gagcgcgagg tccgccggat cctgtccgac       780
     cgggtggagc tgccgaagct catcctggtg tggcacgcgc cggccgccta cgccgacggc       840
     tcggcggagc tggagctcct cgccgacgtc ctggcggagg ggccgtcgtc gcgcctcgac       900
     cgtcggctgg tgcaggagct gcggctcgcc gagtcggtca ccgcctacct cgaccccggg       960
     cggctcggct cgctcttccg cgtcgaggtg accgccacgc ccggcgccga cctggagcgg      1020
     gtgaagcgcg aggcgctcgc ggtggtcgcg gagctccagg cgaaggggcc cgaggcgcgc      1080
     gagctggccc gcgtgcgcgc gcaggcggag cggcggcggc gcgaggagcg cgagcacctc      1140
     gtccaccgtg ccgacaagct gaacgagtac ctcgcctact acggcgagcc ggacggcttc      1200
     gcccgcgacc tcgcccgcgt cacctccgcc accgccggcg ggctgcgcga ggccgcccgc      1260
     gggctcggcg agggccggct cgatctgcgc gtcctccccg cccgcgccgg cgccggcgcc      1320
     gcgaaggcgg agatccccga cgcgccgccg ccgccgctgg ccacgcgccc gttcgacccg      1380
     cccgcgccgg aggtgttccg gctcgcgaac ggcctcgagg tgcgggtcgc cccgcgcccg      1440
     ggcaccgggc tgttcgccgc gcacctgctc ctgcccggcg gggccgcggc ggtcccggcc      1500
     gagaaggccg gcctcgcgcc catcctcgcc gagctgctca cctcgggcgc cggcgggcgc      1560
     agcgccgcgg agtacgccga cgcgatccgc gcgctcggcg cgagcgtcga ggccgaggcg      1620
     cggcccgcgt ccttgcaggt gtcggtgagc gggctctccg cgcacctcgc cccggcgctc      1680
     gatctcttcg cggacgcggt gctgcgcccg aacctggcgc gcgccgactt cgagcgcgag      1740
     gccgcgctgg cgctggcgcg cgtggaggcc cggcccgacg atccgcgcaa ggtggctccg      1800
     gtggtggccg cggccgcgat cttcggccgg ggcgatccgc ggggccgccc ggtggacggc      1860
     tgggccgcca cggtgcgcac cgtcacgctc gacgacgtgc gacgcctcgc gccgcggctg      1920
     ctcgacccgc gcggcgcgac gctggtggtc gcgggcgacg tcgatccggc ggcgctccgg      1980
     cggctgctcg cgccgcggct cggcgcctgg cgcggcgccg gtcccgcgcc cgcggcgagc      2040
     ccggccgcgc tgaccgcggc ccagggcggg cgcatcctgc tggtggaccg gcccggcgcc      2100
     ccgcagaccc gcatcctgct ggcgcgaccg gtcgctcccg cgcccgagcc ggcgcgcgcg      2160
     ctccgcgagc tcgtgaacgt ggtgctgggc gggagcttca cctcgcgcct caaccagaac      2220
     ctgcgcgaga agcacggcta cacctacggc gcgcggagcg cgttcgcgac cgagggcggg      2280
     caggggctgt tcaccgccgg cgcggcggtg cagaccgagg tgacgggcgc ggcgctggtg      2340
     gagctgcggc gggagctcga cgggctcgcc gccgcgggcg tggacgcggc cgagaccgcg      2400
     aaagcgcgcg agacggcgcg gcaccggacg gtggaggaga tccagaccac cgccgggctc      2460
     gccgaggcgc tcgccgcggc cgtcctggaa ggccgccccc ccgacgcgct ccggcgcgag      2520
     gcggaggcgc tcaccgcggt cgagcccgcc cgcgccgccg ccgaggcgaa ggccggcccg      2580
     tacgccttcg gcgggttcac ggtcgtgctg gtcggcgacc ggaagaccgt cgtcccccag      2640
     ctcgagaagg ccgggttccc gcggccggcg gcggtggacc ccgacggcac ccccatcccc      2700
     gacccagagt aa                                                          2712
//

If you have problems or comments...

PBIL Back to PBIL home page