(data stored in ACNUC7421 zone)

EMBL: CP000251.PE297

CP000251.PE297       Location/Qualifiers
FT   CDS_pept        350769..352106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0299"
FT                   /product="oxidoreductase FAD/NAD(P)-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80075"
FT                   /db_xref="GOA:Q2IMP5"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMP5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80075.1"
FT                   /translation="MRAVRLQDLTRVGLWIALYVLLALYPLLWLAAVPAPGGGDFRQEL
FT                   AAALGFLGLSIMAMQFLLTARFQWLAPPFGTDVVYAFHRHVTAVALVFVAAHPLVLLGP
FT                   ELGVGGMAAWLLPWRAPGAVGAGVWSLYALVVLAVTSYGRRRLRLPYEAWRVLHGVAAT
FT                   AAVLLGLWHAAAARRLLAGPVTRVMWIAWTLAWVALLLRVRVAKPLALRARPYRVSEVR
FT                   PERGDAVTLVLDPDGHEGFRFRAGQFAWLALGASPFAAREHPFSISGSSQRAPRVELTV
FT                   KALGDFTRRVQATRPGARAWVDGPYGTMSVDAFPDADGYLFVAGGIGIAPCLSMLRTLA
FT                   DRGDRRPHQLVFGTGRWERTPFREALAELATRLDLTVVHVLEHPPDGWTGEVGVVGEDV
FT                   LRRHLPRGHRGCFVCGPPAMMDAVEKALVRLGVPLRDVHSERFDLV"
     atgagggcgg tccgcctcca ggacctgacg cgcgtcggcc tctggatcgc gctctacgtg        60
     ctcctcgcgc tgtacccgct gctctggctc gccgcggtgc ccgcgcccgg cggcggcgac       120
     ttccggcagg agctcgccgc ggcgctcggg ttcctgggcc tgtcgatcat ggcgatgcag       180
     ttcctgctca ccgcgcgctt ccagtggctc gcgccgccgt tcggtaccga cgtcgtctac       240
     gcgttccacc gccacgtcac cgcggtcgcc ctcgtcttcg tggccgccca cccgctggtg       300
     ctgctcggcc cggagctggg cgtgggtggc atggcggcgt ggctcctccc ctggcgcgcc       360
     ccgggcgcgg tcggcgccgg ggtctggtcg ctgtacgcgc tggtcgtgct cgcggtgacg       420
     tcctacggca ggcggcgcct gcgcctgccg tacgaggcct ggcgcgtgct gcacggcgtc       480
     gccgcgacgg cggcggtgct gctcggcctg tggcacgcgg ccgcggcgcg gcggctcctc       540
     gccggcccgg tgacgcgggt gatgtggatc gcctggacgc tggcctgggt ggcgctgctc       600
     ctccgcgtgc gcgtggcgaa gccgctcgcg ctgcgcgccc gcccgtaccg ggtcagcgag       660
     gtccggcccg agcgcggcga cgcggtgacg ctggtgctcg accccgacgg tcacgagggc       720
     ttccgcttcc gcgccggcca gttcgcctgg ctcgcgctgg gcgcgtcgcc gttcgcggcg       780
     cgcgagcacc cgttctccat ctccggcagc tcgcagcgcg ccccgcgcgt cgagctgacc       840
     gtgaaggcgc tcggcgactt cacccggcgc gtccaggcga cgcggcccgg cgcgcgcgcc       900
     tgggtggacg ggccctacgg gaccatgagc gtggacgcgt tcccggacgc ggacgggtac       960
     ctgttcgtcg cgggcggcat cggcatcgcg ccctgcctgt cgatgctgcg cacgctcgcg      1020
     gaccgcggcg atcgccgccc gcaccagctc gtgttcggca ccggccgctg ggagcggacc      1080
     ccgttccgcg aggcgctggc cgagctcgcg acgcggctcg acctcaccgt ggtgcacgtg      1140
     ctcgagcacc cgccggacgg ctggaccgga gaggtgggcg tggtgggcga ggacgtgctg      1200
     cgccgccacc tgccgcgcgg gcaccgcggc tgcttcgtgt gcgggccgcc ggccatgatg      1260
     gacgcggtgg agaaggcgct ggtccggctc ggcgtcccgc tccgcgacgt ccactccgag      1320
     cgcttcgatc tcgtgtga                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page