(data stored in ACNUC7421 zone)

EMBL: CP000251.PE3

CP000251.PE3         Location/Qualifiers
FT   CDS_pept        2958..4076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79781"
FT                   /db_xref="GOA:Q2ILU8"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2ILU8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79781.1"
FT                   /translation="MKLLSLHVQDFRNLAAVELAPSPRATVLLGENGQGKTNLLEAIYF
FT                   LTTLKPLRAVRLAELVRFGAADAAVAGDFEGPGGVRRVAVQVAAGGRTASLDGKALGSG
FT                   ARLDDYFEGLASVCFSPDDLLLVKAGPDGRRRFLDRAAFNRWPAVLGEAREYVRALRAR
FT                   NAALRSGTAEVEASFREPLVRAGARLLVRRRDLVAELAPRLRAAFAEISGPAAPEADLA
FT                   YRAAGGVEVGHPEAEVAARLARALETRLERDREKGFTSAGPHMDDLVLALGGKGARLYG
FT                   SQGQQRALVLALKIAEIENLRAALGRPPLLLLDDVSSELDPAKNRFLLGYLAALPAQAF
FT                   LTTTDRRLIEPAAGPDTAFYEVRSGVVSPLVS"
     gtgaagctcc tctccctcca cgtccaggac ttccgaaacc tcgccgccgt cgagctcgcg        60
     ccgtcgccgc gggccaccgt gctcctcggc gagaacggcc aggggaagac caacctcctc       120
     gaggccatct acttcctcac cacgctgaag ccgctccgcg cggtgcggct cgcggagctg       180
     gtccggttcg gcgccgccga cgccgcggtg gccggcgact tcgaggggcc gggcggcgtg       240
     cgccgggtgg cggtgcaggt ggccgcgggc ggccgcaccg cctcgctcga cggcaaggcg       300
     ctcggctccg gcgcccgcct cgacgactac ttcgagggcc tcgcctcggt ctgcttctcg       360
     cccgacgacc tcctgctcgt gaaggcgggg ccggacgggc ggcggcgctt cctcgaccgc       420
     gccgcgttca accgctggcc ggcggtgctc ggcgaggcgc gcgagtacgt gcgggcgctg       480
     cgggcccgga acgcggcgct gcgcagcggc acggccgagg tggaggcgag cttccgcgag       540
     ccgctggtgc gcgccggggc gcgcctcctg gtgcggcggc gcgacctcgt ggcggagctc       600
     gccccgcggc tccgggccgc cttcgccgag atctccgggc cggccgcccc cgaggccgac       660
     ctcgcctacc gcgccgccgg cggcgtcgag gtggggcacc cggaggccga ggtggcggcg       720
     cgcctcgccc gcgccctgga gacgcggctc gagcgcgatc gcgagaaggg cttcacgtcg       780
     gccgggccgc acatggacga cctcgtgctc gcgctcggcg ggaagggcgc gcggctctac       840
     gggagccagg gccagcagcg cgcgctcgtg ctcgcgctca agatcgccga gatcgagaac       900
     ctgcgcgcgg cgctggggcg cccgccgctc ctgctgctcg acgacgtctc ctcggagttg       960
     gatccggcca agaaccggtt cctgctcggc tacctggccg ccctgccggc ccaggcgttc      1020
     ctcaccacca ccgaccgccg cctcatcgag ccggccgccg ggcccgacac cgcgttctac      1080
     gaggtgcgat caggggtggt ttccccgctg gtttcgtga                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page