(data stored in ACNUC7421 zone)

EMBL: CP000251.PE301

CP000251.PE301       Location/Qualifiers
FT   CDS_pept        355792..356271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0303"
FT                   /product="protein of unknown function DUF456"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80079"
FT                   /db_xref="GOA:Q2IMP9"
FT                   /db_xref="InterPro:IPR007403"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMP9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80079.1"
FT                   /translation="MEILLYALGAAALVAGVAGVVLPVLPGSLLLVAGAVLVAWAGDFQ
FT                   RVGWGTVAVAAVLSVAIWAVDWLASVLGAKAFGASGWAVAGAGVGLLVGFFLGLPGIVL
FT                   GPAVGAIAFEYARNPDVKRALKAGAGAFLGFVLGSAVKVALAFAVVGAVALALIW"
     atggagatcc tgctctacgc gctcggcgcc gccgcgctcg tcgccggcgt ggccggcgtg        60
     gtcctgccgg tgctgccggg gtcgctgctg ctcgtggcgg gcgccgtgct ggtggcctgg       120
     gccggggact tccagcgcgt gggctggggc accgtggcgg tcgcggcggt gctctcggtc       180
     gcgatctggg ccgtggactg gctcgcgagc gtgctcggcg cgaaggcgtt cggcgcgtcg       240
     ggctgggcgg tggccggcgc gggcgtgggg ctgctggtgg gcttcttcct cgggctgccc       300
     gggatcgtgc tcgggcccgc cgtgggcgcg atcgcgttcg agtacgcgcg gaaccccgac       360
     gtgaagcggg cgctgaaggc gggcgcgggc gcgttcctcg gcttcgtgct ggggagcgcc       420
     gtcaaggtgg cgctcgcgtt cgccgtggtc ggcgccgtgg cgctcgcgct catctggtag       480
//

If you have problems or comments...

PBIL Back to PBIL home page