(data stored in ACNUC7421 zone)

EMBL: CP000251.PE306

CP000251.PE306       Location/Qualifiers
FT   CDS_pept        360166..361359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0308"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80084"
FT                   /db_xref="GOA:Q2IMQ1"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMQ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80084.1"
FT                   /translation="MGAAARRALAGALALAAAMGIGRFAYTALLPGVQRGLGFDDAAGG
FT                   AIASANLVGYLAGVLWARRLAGSARRGAALRLGLAATAVLTAAVTAVGSEMGWAAVRFG
FT                   SGVASGLVFVLASAAALEVAPGHLPRPGVLYGGVGVGIALAAVVAAVAPPAGGWRIPWW
FT                   VLGGAAAALAVPGWRDLSAPLAHDSGSGGAGSGGAAVASGRGRPAVGFGRLATAYFLEG
FT                   LGYIVSGTFAVAAVRRTPGLEALAPWTWAMAGLAAAPSALLWASFGRRVGVRSALVAAH
FT                   LVQAAGMALPSLSSAAWAALAGAALFGGTFIGITTLTVAAAREIRPNALGRAVGTLTAI
FT                   YGVGQIVGPLAAGAVAQHLGDPRPAVLGAAAAVALGAVVLLMPSRPSVMAPAPDRGR"
     ttgggcgccg ccgcacgccg cgcgctcgcc ggcgcgctcg ccctcgccgc cgcgatgggg        60
     atcggacggt tcgcgtacac cgcgctcctg cccggcgtgc agcgcgggct cgggttcgac       120
     gacgccgccg gcggggccat cgcgtcggcc aacctggtcg gctacctcgc cggcgtgctc       180
     tgggcgcggc gcctcgccgg gagcgcgcgg cgcggcgcgg cgctgcggct cggcctggcg       240
     gcgaccgccg tgctcaccgc ggccgtcacc gcggtcggct ccgagatggg gtgggccgcc       300
     gtgcgcttcg gctccggcgt cgcgagcggg ctcgtgttcg tgctcgcgtc cgccgccgcg       360
     ctcgaggtcg cccccggcca ccttccccga cccggagtac tttacggcgg ggtgggggtc       420
     gggatcgcgc tcgcggccgt ggtcgcggcg gtggcgcccc ctgccggggg ttggcgcatc       480
     ccgtggtggg tgctgggggg cgcggcggct gcgctggcgg tgccggggtg gagggatctg       540
     tccgcgccgc tcgcgcacga ctctgggtcg ggaggagcgg ggtcgggagg agcggcggtc       600
     gcgagcggga ggggccgccc agcggtcggc ttcgggcggc ttgcgaccgc gtacttcctc       660
     gaggggctcg gctacatcgt gagcgggacg ttcgcggtgg cggcggtccg gcggacgccc       720
     gggctggagg cgctcgcgcc gtggacgtgg gccatggcgg gcctcgcggc cgccccgtcc       780
     gcgctgctct gggcgtcgtt cgggcgccgg gtcggcgttc ggtccgcgct ggtcgcggcg       840
     cacctcgtcc aggcggcggg catggcgctg ccgtcgctgt cctcggccgc ctgggccgcc       900
     ctcgcgggcg cggcgctgtt cggcggaacg ttcatcggga tcaccacgct gacggtggcg       960
     gccgcgcgcg agatccggcc gaacgcgctc gggcgcgccg tgggaacgct caccgccatc      1020
     tacggcgtcg gccagatcgt cggcccgctg gccgccggag ccgtcgcgca gcacctcggc      1080
     gatccgaggc ccgccgtgct cggcgccgcc gccgcggtcg ccctcggcgc ggtcgtcctc      1140
     ctcatgccct cgcgtccgtc cgtgatggcc ccggctccgg atcggggacg ctga            1194
//

If you have problems or comments...

PBIL Back to PBIL home page