(data stored in ACNUC7421 zone)

EMBL: CP000251.PE318

CP000251.PE318       Location/Qualifiers
FT   CDS_pept        complement(371948..372721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0320"
FT                   /product="BioH protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80096"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMR4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80096.1"
FT                   /translation="MSPCHTMTASDGPLLTLLLPGLDGTGRLLERFVAAASGTLELRTL
FT                   SYPPDRVRSYAELAELVRAELPRGRRFALLGESFGGPLALRVAAGRPPGLVGVVLAASF
FT                   HRRPAARLVSALRPLSPAFFRLPLPAHAVRVLLAGHDAPDALVADVQAAVASVQPRVMA
FT                   RRAHEALHVDATGWLRDCPAPVLFLGGRQDRLLRTGLAIEIRLVRPDAEIRMLDAPHLV
FT                   LQRRPDEAMRAVEGFLARSPAATAPLRAASADEPA"
     gtgtcaccgt gtcacaccat gaccgcctcc gacggaccgc tgctcacgct gctcctgccc        60
     ggcctggacg gcaccggccg gctcctcgaa cggttcgtgg ccgccgcgag cggcacgctc       120
     gagctgcgca ccctgtcgta cccgccggac cgcgtgcgct cgtacgccga gctcgccgag       180
     ctcgtgcgcg ccgagctgcc gcgcgggcgg cgcttcgcgc tcctcggcga gtccttcggc       240
     ggaccgctcg cgctgcgcgt cgccgcaggg cggccgccgg ggctggtcgg ggtggtgctg       300
     gcggcgagct tccaccggcg cccggcggcg cggctggtgt cggcgctccg gccgctctcg       360
     cccgcgttct tccggctgcc gctgcctgcg cacgcggtgc gggtgctgct cgccgggcac       420
     gacgcgcccg acgcgctggt ggccgacgtg caggccgcgg tcgcgtcggt ccagccgcgg       480
     gtgatggcgc gccgcgcgca cgaggcgctg cacgtggacg cgaccggctg gctccgcgac       540
     tgcccggcgc cggtgctgtt cctgggcggg cggcaggacc ggctgctccg caccgggctc       600
     gccatcgaga tccggctggt gcgcccggac gccgagatcc gcatgctcga cgcgccgcac       660
     ctcgtcctgc agcggcggcc cgacgaggcg atgcgcgcgg tggaggggtt cctcgcgcgc       720
     tcgccggcgg ccaccgcgcc gctgcgcgcg gcgtccgccg acgagcccgc ctga             774
//

If you have problems or comments...

PBIL Back to PBIL home page