(data stored in ACNUC7421 zone)

EMBL: CP000251.PE319

CP000251.PE319       Location/Qualifiers
FT   CDS_pept        372915..373748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80097"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMR3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80097.1"
FT                   /translation="MIGWISALALAAAVALVGVRRARFAREVAAEARSLWAVREDAPPS
FT                   RLDPGTLPEPVRRYLGLAGALGAAPLTAARLRHGGTFRPALEGAWRPIRGVQYLAAEPP
FT                   GFVWWGRVRLAPGLEVAARDRSAGGEGGMRIALASALVVADVTGPEIDAAALQRLLGEL
FT                   VWLPTALLDARHVAWLPRDASSARARLRVGGREVEATFHFGGDGLPERITALRYRDVKG
FT                   RGVLTPWTGRCADWREVGGVRVPFRMEASWELDGRDRPYARFELERLEHGVPRPF"
     atgatcgggt ggatcagcgc gctcgcgctc gccgccgccg tcgcgctcgt gggcgtgcgg        60
     cgcgcccggt tcgcgcggga ggtcgcggcg gaggcgcgat cgctctgggc ggtccgggag       120
     gacgcgccgc cgtcccgcct cgatcccggg accctgcccg agccggtgcg gcgctacctc       180
     gggttggccg gggcgctcgg ggcggcgccg ctcaccgcgg cccggctccg ccacggcggc       240
     accttccggc cggcgctcga gggcgcgtgg cggccgatcc gcggcgtgca gtacctcgcc       300
     gccgagccgc cgggcttcgt gtggtgggga cgcgtgcggc tcgcgcccgg gctggaggtc       360
     gcggcgcggg atcgctcggc cggcggcgag ggcggcatgc gcatcgcgct cgcctccgcc       420
     ctggtggtgg ccgacgtcac cggtccggag atcgacgcgg ccgcgctgca gcggctgctc       480
     ggcgagctcg tgtggctccc gacggcgctg ctcgacgcgc ggcacgtggc gtggctgccg       540
     cgcgacgcct cgagcgcgcg ggcgcggctg cgcgtgggcg ggcgggaggt ggaggcgacc       600
     ttccacttcg gcggcgacgg cctcccggag cggatcacgg cgctgcgcta ccgcgacgtg       660
     aagggccggg gcgtgctcac gccgtggacc gggcgctgcg ccgactggcg cgaggtgggc       720
     ggcgtgcgcg tcccgttccg gatggaggcg agctgggagc tcgacggccg cgaccgtccg       780
     tacgcgcgct tcgagctgga gcggctggag cacggggtcc cgcgaccgtt ctag             834
//

If you have problems or comments...

PBIL Back to PBIL home page