(data stored in ACNUC7421 zone)

EMBL: CP000251.PE325

CP000251.PE325       Location/Qualifiers
FT   CDS_pept        385200..385688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0327"
FT                   /product="protein of unknown function DUF59"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80103"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMS1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80103.1"
FT                   /translation="MPFRPNARSRASRALEWTFAALLLGASAAILVAAGVSRADAHYQW
FT                   TRPAGDPARGAVTPAAVWERLRTVLDPELGIDVVDLGLVYDVTVPRDGRVAVVMTLTSA
FT                   GCPFSKQMIEDVRRAIFQHPAVREVALTVTRDPPWSWDRVSLEARKRIVEGSHAGAHR"
     atgccgttcc gcccgaatgc acgaagccgc gcctcgcgcg ccctggagtg gaccttcgcg        60
     gccctgctgc tgggggcatc cgccgcgatc ctcgtggccg cgggcgtgag ccgcgcggac       120
     gctcactatc agtggacaag gccggcggga gatcccgcgc gcggcgcggt caccccggcc       180
     gccgtgtggg agcggctccg gacggtgctc gatcccgagc tcggcatcga cgtggtggac       240
     ctgggcctcg tctacgacgt cacggtgccg cgcgacggcc gggtggccgt ggtgatgacg       300
     ctcacctccg cgggctgccc gttctcgaag cagatgatcg aggacgtgcg ccgcgcgatc       360
     ttccagcacc cggcggtgcg cgaggtggcg ctcaccgtca cccgggaccc gccctggagc       420
     tgggaccgcg tgagcctgga ggcccggaag cggatcgtgg agggatcgca cgcgggggcg       480
     catcgatga                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page