(data stored in ACNUC7421 zone)

EMBL: CP000251.PE326

CP000251.PE326       Location/Qualifiers
FT   CDS_pept        385685..386311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0328"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80104"
FT                   /db_xref="GOA:Q2IMS0"
FT                   /db_xref="InterPro:IPR039447"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMS0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80104.1"
FT                   /translation="MTLLGPLSSGFLLGLGTGPLCFIGCIPLALPFALPEAGAGPRRGA
FT                   WGFLAKFLAGRLVAYSTVGVLTGLASSMAGPVQRRVVTVAWLALSVVLIVHGLGRGLPH
FT                   RGACGAVARVARSRAFPFLLGLAAALSVCPPFLLAVAYAMDRSGQVVGGLAFFLAFFAA
FT                   TTLYVVPVALLGYLPRRDLWQRVGRGASVIAGIALLVQGVRELLA"
     atgaccctgc tcggcccgct ctccagcggc ttcctgctcg ggctgggcac gggtccgctc        60
     tgcttcatcg ggtgcatccc gctggcgctg cccttcgcgc tgccggaggc gggggccggg       120
     ccgcggcgcg gcgcctgggg gttcctggcg aagttcctgg ccggccgcct ggtcgcgtac       180
     tcgacggtcg gcgtgctcac cggcctcgcg tcgtcgatgg ccgggcccgt gcagcgccgg       240
     gtggtgacgg tggcctggct ggcgctgagc gtggtgctga tcgtgcacgg cctcgggcgc       300
     ggcctgccgc accgcggggc gtgcggcgcg gtcgcgcgcg tggcgcggtc gcgcgcgttc       360
     cccttcctgc tcgggctcgc cgccgcgctg tcggtctgcc ccccgttcct gctcgcggtg       420
     gcctacgcga tggatcgctc ggggcaggtg gtgggcgggc tcgccttctt cctcgccttc       480
     ttcgccgcca ccaccctcta cgtcgtgccc gtcgcgctgc tcggctacct gccgcggcgc       540
     gacctgtggc agcgcgtggg gcgcggcgcg tcggtcatcg cggggatcgc gctgctggtg       600
     cagggagtgc gggagctact ggcgtag                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page